Corynebacterium kutscheri: UL82_09205 Help Entry UL82_09205        CDS       T03866                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cku  Corynebacterium kutscheri Pathway cku01100   Metabolic pathways cku01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cku00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     UL82_09205    00074 Mycolic acid biosynthesis     UL82_09205   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     UL82_09205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AKE41981 UniProt:  A0A0F6TDZ6 LinkDB All DBs Position 1981587..1981868 Genome browser AA seq 93 aa AA seqDB search MRSLSDQLAALQTDTTDKEESTAQRVIRLLAEITHTDAEKIIPEMSLSDAGIESLEKIEL AIRIEQIFQVPAEPENYLNIDTIEQLIQLIDAG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgcgttctctttccgaccagctagccgcgctacaaaccgatacaaccgataaggaagaa tcaaccgctcagcgtgttatccgcttgcttgccgaaatcacccacaccgatgccgaaaaa atcatcccagaaatgtcgttaagcgatgccgggatagaatctttagaaaaaatcgaacta gcaatacgcatcgagcaaattttccaggttcctgccgagccagaaaattacctaaacatc gacacaatcgagcaacttatccagcttatcgacgctggctaa

DBGET integrated database retrieval system