Clostridium sp. BNL1100: Clo1100_1764 Help Entry Clo1100_1764      CDS       T01708                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism clb  Clostridium sp. BNL1100 Pathway clb01100   Metabolic pathways clb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:clb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Clo1100_1764    00074 Mycolic acid biosynthesis     Clo1100_1764   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Clo1100_1764 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Ribosomal_L50 PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AEY65974 LinkDB All DBs Position 2034814..2035041 Genome browser AA seq 75 aa AA seqDB search MVFDKVKKLIVEQLGVEEEDITMEASFIDDLGADSLDIVELIMALEEEFGLEIPDTEAEK ITTVSDVVEYIKSNT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggtttttgataaagttaaaaaattgattgttgagcagttgggtgttgaagaagaagat ataactatggaagcttccttcatagatgatcttggagctgattctcttgatatagtagag cttataatggctcttgaagaggaatttggtcttgagatacctgataccgaagcagagaag atcacaacagttagtgatgttgttgaatacatcaaaagtaatacttaa

DBGET integrated database retrieval system