Clostridium sp. BNL1100: Clo1100_3273 Help Entry Clo1100_3273      CDS       T01708                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism clb  Clostridium sp. BNL1100 Pathway clb01100   Metabolic pathways clb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:clb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Clo1100_3273    00074 Mycolic acid biosynthesis     Clo1100_3273   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Clo1100_3273 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AEY67419 LinkDB All DBs Position complement(3739685..3739918) Genome browser AA seq 77 aa AA seqDB search MIEKIKEILAKYAEVGIDKINDESRLVGDLGLDSMDLVDLVIDLEDEFGVEINDRDLWNI QTFGDIKIYLSDRTQKD NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgattgagaaaataaaagaaatattggcaaagtatgctgaggtgggtattgataaaatt aatgatgaatccagacttgtgggggacttaggtcttgattcaatggatttggtggattta gttatcgatttagaggatgaatttggggttgaaattaatgatagagatttatggaacata cagacctttggcgatattaagatctacttgtctgatagaactcaaaaggattaa

DBGET integrated database retrieval system