KEGG   Cimex lectularius (bed bug): 106661634
Entry
106661634         CDS       T05603                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
clec  Cimex lectularius (bed bug)
Pathway
clec00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:clec00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    106661634
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:clec00199]
    106661634
Enzymes [BR:clec01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     106661634
Cytochrome P450 [BR:clec00199]
 Cytochrome P450, animal type
  CYP306 family
   106661634
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 106661634
NCBI-ProteinID: XP_014240651
UniProt: A0A7E4S7X7
LinkDB
Position
Unknown
AA seq 492 aa
MDIMVTMAIALLIGYLLYVYSKWKSFPPGPWGLPIVGYLPWIDKDKPYITLTELARRYGP
IYSVSMGSVSTVVVSDAQLIKNALSRDVFSARANLYLTHGIMKGYGLIAAEGEKWKEQRR
FVSSFLKGLGVVKVGAKRALMEKKILEGVREAVGMLSRLDGKAEDPHNILLHSIGNVINL
VVFGKTWAYDDPQWIWLRRLLADGIKLIGIVGPVNFLPFLRWWPGYNRLLRYLKDGKSET
HKVYKEISDGSSTDGEHLLANYKAAMANSQGRHFEEKQMFHVLADMFGAGTDTTLSTLRW
FLLFMAVNPSIQSRVREELEKALNGRQDPTLEDMENLPYTMACLFETQRIRVITPLGIPH
GTWEETDLGGYRIPRGAMIMVLQWAVHMDPEVWDDPESFRPERFIDSEGKVIKNHHNFMP
FQCGKRICLGEEMAKMMLFLFGAGILCRFVVRVLEKGDDLQKALEGNMGITFSPESHHLV
FQEKTSVQADGT
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggatatcatggtgaccatggcgattgctcttttaatcggctatctgctttatgtctat
tcgaaatggaaatcgttcccccctgggccctggggtcttcccatcgtcggctacctgccc
tggatcgacaaggacaaaccatacatcacactgactgaactggcgagacgttacggcccc
atctatagcgtgtcgatgggctcggtctcgaccgtcgttgtctccgacgcgcagctgatc
aagaacgcgttatccagggacgttttctctgcgagggccaacctctacctcacacatgga
attatgaaaggatacgggctgatcgctgccgaaggtgaaaaatggaaggagcagcgacgt
ttcgtgtcgtctttcctgaaggggctcggagtcgtgaaagtcggcgcaaagagggcgttg
atggagaagaaaattctcgaaggcgtccgtgaagcagtcgggatgctgagtcgactcgat
ggaaaagcggaggatcctcacaacatccttcttcactccatcggcaacgtgatcaacttg
gtcgtcttcggaaagacatgggcatacgacgacccccagtggatctggctaaggcgtctt
ctagcagacggaatcaaactaatcggcattgtagggcctgtcaatttcttgccttttttg
aggtggtggcctggttacaaccgtttgttgcgctacctgaaagacggaaagtcggagacg
cacaaggtctacaaggagatctcggacggctcgtcgacggacggcgaacatctcctcgcc
aattataaagcggccatggcgaactcgcaaggaagacattttgaggaaaaacagatgttc
cacgttttggcggacatgtttggggccggaaccgacaccacgctctccacgctcaggtgg
ttcctgcttttcatggcggtcaacccctccatacagagcagagtgagggaggagttggaa
aaggcgctaaacggccggcaagatccgaccttggaagacatggaaaacttgccgtacacc
atggcatgtctgtttgaaacccaaaggatccgagtgatcacacctctgggcattccgcat
ggtacgtgggaggagacggatctaggaggatacagaatccctcgaggcgcgatgatcatg
gtactccaatgggctgtccatatggatccggaggtatgggacgacccggagtctttccga
cccgaaaggtttatcgattcggaaggaaaagtgattaaaaatcaccacaacttcatgccg
tttcaatgcgggaaaaggatttgcctaggcgaggaaatggctaagatgatgctgtttctg
tttggagccggcatcctgtgcagattcgtcgtccgcgtattagaaaagggtgatgatctt
cagaaagcgttggaaggcaacatgggcatcacattcagccctgagagccatcatctcgta
tttcaagagaagaccagtgtgcaagcggatggaacatga

DBGET integrated database retrieval system