Cimex lectularius (bed bug): 106670837 Help Entry 106670837         CDS       T05603                                  Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism clec  Cimex lectularius (bed bug) Pathway clec04144   Endocytosis clec04517   IgSF CAM signaling clec04518   Integrin signaling clec04519   Cadherin signaling clec05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:clec00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     106670837    04518 Integrin signaling     106670837    04519 Cadherin signaling     106670837  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106670837  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     106670837  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clec04131]     106670837    03036 Chromosome and associated proteins [BR:clec03036]     106670837   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clec04147]     106670837    04031 GTP-binding proteins [BR:clec04031]     106670837 Membrane trafficking [BR:clec04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     106670837  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     106670837   Macropinocytosis    Ras GTPases     106670837 Chromosome and associated proteins [BR:clec03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     106670837 Exosome [BR:clec04147]  Exosomal proteins   Exosomal proteins of microglial cells    106670837   Exosomal proteins of breast milk    106670837 GTP-binding proteins [BR:clec04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     106670837 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  106670837 NCBI-ProteinID:  XP_014256959 UniProt:  A0A8I6S715 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVREKWVPEITHHCQKTPFLLVGTQIDLR DDAATTEKLAKNKQKPITFEQGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALEPP EPAKKRKCAIL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacaatcaagtgtgtcgttgtcggggatggggcggtgggtaagacatgccttctg atatcgtacacgacgaacaaattcccgtcagaatatgtgccaactgtattcgataattat gctgtgactgtcatgatcggcggcgaaccctataccttagggctgttcgacactgcaggc caggaagattatgacaggctaaggccgttaagttacccgcagacggacgtgtttttagtg tgtttttccgttgtatcgccttcttcgtttgaaaacgtccgagaaaagtgggtgcctgaa ataacacaccactgtcagaaaacgccgtttctccttgtcgggacgcagattgacctgaga gacgatgcggcgacaaccgagaagctggcgaaaaacaagcagaagccgataacattcgag cagggcgagaagcttgccaaggagctaaaggcggtcaaatatgtcgagtgctcggcgctg acgcagaaaggactcaagaatgtcttcgatgaggcgatactcgcagcgctcgagccgccc gaaccggccaagaaaaggaagtgcgccattctttag

DBGET integrated database retrieval system