KEGG   Corynebacterium lizhenjunii: G7Y31_09390
Entry
G7Y31_09390       CDS       T07490                                 
Name
(GenBank) SulP family inorganic anion transporter
  KO
K03321  sulfate permease, SulP family
Organism
cliz  Corynebacterium lizhenjunii
Brite
KEGG Orthology (KO) [BR:cliz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cliz02000]
    G7Y31_09390
Transporters [BR:cliz02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   G7Y31_09390
SSDB
Motif
Pfam: Sulfate_transp STAS STAS_2
Other DBs
NCBI-ProteinID: QPK78747
UniProt: A0A7T0PBI4
LinkDB
Position
complement(2008611..2010167)
AA seq 518 aa
MRFESLSSPRFAANLHQSCEDEVVTTTAEPAAPTGVIDSFRFAFSSPRRLRIEILGGLTV
SLALIPEAIAFSILAGVSPAVGLFTSVIMAMVISFSGGRPAMISAATGAIALVVAPVSRA
YGLDYLVATVLLGGLLQLAFAALGVARLQRFIPRSVMLGFVNALGMMIFIAQLQHLVNVP
WMVYPLTAAGIVLMLVWPRLVQAVPAPLVTIIVLGSITTLASINVPRVADMGELPSSLPS
LFFPTVPWELETLRIIAPYAVGVAIVGLMESLMTAKLVDDITDVHSDKTRESFGQGVANV
ASGLCGGMGGCAVIGQTLINVRESGARTRLSTFLAGGFLLVLLLVLGDIVGQIPMAALVA
IMMMVSIGTIDWHSLRPRTLKFMPVSETVAMGVTMAGTLLTHNLAVGVIAGVLTATLTFA
HKVAHLVRVEREGRDVYRITGQLFWASSNDLVYQFDYTDPPERVVIDLSGAEVWDASTVA
TLDSITRKYHERGAAVEIIGLDGPSRARLDKLTGQLGD
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgaggttcgaatctctgtcaagtccgcgcttcgctgcgaacctgcaccaatcctgtgag
gatgaagtagtgaccacaacggctgaacccgccgcgcccactggggtaatagactctttc
cgcttcgcgttttcctcgccgcgccgcctgcgcattgagatactgggcgggctgacggtg
tctctggcactgattccggaggcgattgctttttccatcctggcgggggtcagcccagcg
gtggggttgtttacttcagtgattatggccatggtgatttctttcagcggcgggcgtcca
gccatgatatccgcggccacgggggcgattgccctggtggtggcgccggtgtcgcgggcc
tatgggctggactacctggtggccacggttttgctgggcggtctgctgcagctggcgttt
gcggcactgggtgtggcgcggttgcagcgctttattccgcgctcggttatgttgggcttc
gtcaacgccttgggcatgatgatcttcatcgcccagctgcagcatctggtgaacgtgccg
tggatggtgtacccgctcacggcggccggcattgtgctgatgctcgtctggccgcggctg
gtgcaggccgttccggcgccgctggtgaccattatcgtgctgggatctatcaccacactg
gcctcgatcaacgtgccacgcgtggcggacatgggggagttgcccagctcgttgccgagc
ctgtttttccccaccgtgccgtgggagctggagaccttgcgcatcattgccccgtacgcg
gtgggggtggcgattgtgggcctgatggagtcgctgatgacggccaagctcgttgatgac
atcaccgacgtacactccgataagacccgggagagcttcggtcagggcgtggctaatgtg
gccagcgggctgtgcggcggcatgggcgggtgcgcggtgattggccagacgctgattaac
gtgcgcgaatccggggcgcgcactcgcctgtcgacgtttttggccggcggcttcctgctg
gtgttgctgctggtgttgggcgatattgtgggccagattcccatggcggcgctggtggcg
atcatgatgatggtttccatcggcaccattgattggcactcgctgcgcccccgcacactg
aagttcatgccggtctcggagacggtggccatgggcgtgaccatggcgggcacgctgctg
acgcataatctagccgtgggggtgattgcgggcgtgttgaccgccacgctgacctttgcg
cacaaggtcgcccacctggtgcgggtggagcgcgagggccgcgacgtctaccgcattacc
gggcagttgttttgggcctcgtccaatgatttggtctatcagtttgattacaccgatccg
ccggagcgcgtggtcattgacttgagcggggcggaggtgtgggatgcctctacggtggcc
acgctggattcgattacccgcaagtatcacgagcgcggcgccgccgtggagattattggt
ttggatggccccagtcgcgcccggcttgataagctcaccgggcagttgggcgattag

DBGET integrated database retrieval system