Clostridium sp. MF28: AXY43_25210 Help Entry AXY43_25210       CDS       T11014                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism clom  Clostridium sp. MF28 Pathway clom00998   Biosynthesis of various antibiotics clom01100   Metabolic pathways clom01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:clom00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AXY43_25210    00074 Mycolic acid biosynthesis     AXY43_25210   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AXY43_25210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N PP-binding_2 Motif Other DBs NCBI-ProteinID:  AVK51053 LinkDB All DBs Position 5789173..5789415 Genome browser AA seq 80 aa AA seqDB search MSNLGTFNKIIKSVWSIENLDEIEDGFGPDEIEAWDSLSHIELVVALEEEFEISMAVQDI SRLYTIGDIKNTLKRYGVEI NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagtaatttaggaactttcaacaaaataataaaatctgtttggagtattgaaaattta gatgaaattgaagacggttttggtccagacgaaattgaggcatgggattcacttagccat attgaactagtagtagcccttgaggaagaatttgaaatatctatggcagttcaagatatt tcaaggttatatactataggagatatcaaaaatacattgaaaagatatggggttgaaata tga

DBGET integrated database retrieval system