Condylostylus longicornis: 129607117 Help Entry 129607117         CDS       T09756                                  Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism clon  Condylostylus longicornis Brite KEGG Orthology (KO) [BR:clon00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:clon03037]     129607117 Cilium and associated proteins [BR:clon03037]  Primary cilia and associated proteins   BBSome    129607117 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  BBIP10 Motif Other DBs NCBI-GeneID:  129607117 NCBI-ProteinID:  XP_055373830 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MSNSQNLEKIDLIAPTTGKLFFEKKIDLEFCKPHLMPLKSVTLEAVERMQKEAHRQLQEN SAKTASETQYQNI NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgtcaaatagccaaaatttagaaaagattgatcttatagccccaacaacaggaaaatta ttttttgaaaagaaaattgatttagagttttgcaagcctcatctaatgcctctcaagtca gttacactagaggcagtagaaagaatgcaaaaagaagcacatcgacaacttcaagaaaat agtgcgaaaacagcatcagaaacacagtatcaaaatatataa

DBGET integrated database retrieval system