Condylostylus longicornis: 129613071 Help Entry 129613071         CDS       T09756                                  Name (RefSeq) ras-related protein Rac1-like   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism clon  Condylostylus longicornis Pathway clon04013   MAPK signaling pathway - fly clon04145   Phagosome clon04148   Efferocytosis clon04310   Wnt signaling pathway clon04620   Toll-like receptor signaling pathway clon05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:clon00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     129613071    04310 Wnt signaling pathway     129613071  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     129613071    04148 Efferocytosis     129613071  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129613071  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     129613071  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clon04131]     129613071   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clon04147]     129613071    04031 GTP-binding proteins [BR:clon04031]     129613071 Membrane trafficking [BR:clon04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     129613071  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     129613071   Macropinocytosis    Ras GTPases     129613071  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     129613071 Exosome [BR:clon04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129613071   Exosomal proteins of other body fluids (saliva and urine)    129613071   Exosomal proteins of colorectal cancer cells    129613071   Exosomal proteins of bladder cancer cells    129613071 GTP-binding proteins [BR:clon04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     129613071 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  129613071 NCBI-ProteinID:  XP_055382963 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MQFIKCVVVGDGAVGKTCLLISYTTNSFPGEYIPTVFDNYSTNVMVDGKPISLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLDNPASFENVRAKWFPEIRHHKPNTPIILVGTKLDLR DNKDVIEKLRVKKLSPVAYPQGLGMAKDIGAVKYLECSALTQKGLKTVFDEAIRSVLCPT MNKKTKKNKCTLF NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgcaatttataaaatgtgttgtagttggtgatggtgctgttggaaaaacatgcctatta attagttatacaacaaattcatttcctggtgaatatataccaactgtatttgacaattat tctacaaatgttatggttgatggtaagccaattagtcttggcttatgggatacagctggt caagaggattacgatcgtttaagaccattatcatatccacaaaccgatgtatttttaata tgcttttcattagataatccagcttcatttgaaaatgtaagagcgaaatggtttccagaa atacgtcatcataaaccgaatacaccaattatattagttggtacaaaattagatttgaga gataataaagatgttatagaaaaattacgtgtaaaaaaattatctccagtagcttatcca caaggtttgggaatggcaaaagatatcggtgctgttaaatatttagaatgttcagcttta acacaaaaaggtcttaaaacagtttttgatgaggcgatcagatcagttttatgtcctaca atgaataagaaaactaaaaaaaataaatgcactttattttaa

DBGET integrated database retrieval system