Campylobacter lari RM16701: UPTC16701_0293 Help Entry UPTC16701_0293    CDS       T03550                                  Symbol acpP1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism clr  Campylobacter lari RM16701 Pathway clr01100   Metabolic pathways clr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:clr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     UPTC16701_0293 (acpP1)    00074 Mycolic acid biosynthesis     UPTC16701_0293 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     UPTC16701_0293 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L12_N PP-binding_2 DUF3219 Motif Other DBs NCBI-ProteinID:  AJD04363 LinkDB All DBs Position 259864..260097 Genome browser AA seq 77 aa AA seqDB search MAIFDDVKKVVVEQLSVDEDAVKMESKIIEDLGADSLDVVELVMALEEKFDVEIPDSDAE KLVKIEDVVNYIENLQK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcaatttttgatgatgtaaaaaaagtagttgttgagcaacttagtgttgatgaagat gcagttaaaatggaatctaaaatcattgaagatttaggtgcagattctttagatgttgtt gaattagttatggctttagaagaaaaatttgatgtagaaattccagacagcgatgctgaa aaactagtaaaaatcgaagatgttgttaattatatagaaaatcttcaaaaataa

DBGET integrated database retrieval system