Clostridium sp. SY8519: CXIVA_11220 Help Entry CXIVA_11220       CDS       T01565                                  Name (GenBank) ferredoxin 3   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism cls  Clostridium sp. SY8519 Pathway cls00020   Citrate cycle (TCA cycle) cls00720   Other carbon fixation pathways cls01100   Metabolic pathways cls01110   Biosynthesis of secondary metabolites cls01120   Microbial metabolism in diverse environments cls01200   Carbon metabolism cls01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:cls00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     CXIVA_11220   09102 Energy metabolism    00720 Other carbon fixation pathways     CXIVA_11220 Enzymes [BR:cls01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      CXIVA_11220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_9 Fer4_21 Fer4_10 Fer4_16 Fer4_2 Fer4_6 Fer4_17 LdpA_Fe-S-bd Fer4_8 Fer4_4 Fer4_18 Fer4_13 Fer4_3 Fer4_15 Motif Other DBs NCBI-ProteinID:  BAK47089 LinkDB All DBs Position 1210690..1210902 Genome browser AA seq 70 aa AA seqDB search MGKGTIKVVAERCKSCGYCVKFCPKNVLEIGTEVNSKGYEYVTPARMDDCIACCVCGRIC PDGAIEIYKN NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgggtaaaggaacgatcaaggttgtggcagagcgctgcaagagctgtggctactgcgtg aagttctgtccgaagaatgtactggaaatcggtacagaggtaaactcgaaaggttatgaa tatgtaacgccggcacgtatggatgactgcatcgcctgctgtgtctgcggacggatctgt ccggacggtgcgattgagatatataagaattag

DBGET integrated database retrieval system