Clavispora lusitaniae ATCC 42720: CLUG_01320 Help Entry CLUG_01320        CDS       T01149                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism clu  Clavispora lusitaniae ATCC 42720 Pathway clu04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:clu00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     CLUG_01320  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:clu01009]     CLUG_01320   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clu04131]     CLUG_01320    03036 Chromosome and associated proteins [BR:clu03036]     CLUG_01320   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clu04147]     CLUG_01320 Protein phosphatases and associated proteins [BR:clu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      CLUG_01320 Membrane trafficking [BR:clu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     CLUG_01320 Chromosome and associated proteins [BR:clu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      CLUG_01320 Exosome [BR:clu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    CLUG_01320 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_5 EF-hand_6 EF-hand_FSTL1 EF-hand_9 AIF-1 Dockerin_1 UPF0154 EH SPARC_Ca_bdg TerB EF-hand_11 EF-hand_EFHB_C Poly_export DUF5580_M EF-hand_STIM1 EF_EFCAB10_C FCaBP_EF-hand Motif Other DBs NCBI-GeneID:  8498600 NCBI-ProteinID:  XP_002617861 UniProt:  C4XZD8 LinkDB All DBs AA seq 113 aa AA seqDB search MRSLGQNPSESELTDMINEVDINSDGSIDFPEFLTMMARKMKDTDSEAEIAEAFKVFDRN GDGKISATELRHVLTSIGEKLSDADVDQMIREADTNNDGEIDIKEFTQLLAAK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgagatcgttgggtcagaacccttccgaaagtgaattgaccgacatgattaacgaagtt gatatcaacagtgacggatccattgacttccctgagtttttgaccatgatggccagaaag atgaaggacacagattctgaggctgagattgccgaagcattcaaggtttttgacagaaac ggcgatggcaaaattagtgcaacggaattaagacatgttttgacctccattggcgagaaa ttgtctgatgcggatgtagaccaaatgatcagagaagcagacaccaataacgatggtgaa atcgacatcaaggagtttacacagttattggcagcgaaatag

DBGET integrated database retrieval system