Clavispora lusitaniae ATCC 42720: CLUG_02994 Help Entry CLUG_02994        CDS       T01149                                  Name (RefSeq) hypothetical protein   KO K10881   26 proteasome complex subunit DSS1 Organism clu  Clavispora lusitaniae ATCC 42720 Pathway clu03050   Proteasome clu03440   Homologous recombination Brite KEGG Orthology (KO) [BR:clu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     CLUG_02994   09124 Replication and repair    03440 Homologous recombination     CLUG_02994  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:clu03019]     CLUG_02994    04131 Membrane trafficking [BR:clu04131]     CLUG_02994    03051 Proteasome [BR:clu03051]     CLUG_02994    03400 DNA repair and recombination proteins [BR:clu03400]     CLUG_02994 Messenger RNA biogenesis [BR:clu03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      CLUG_02994 Membrane trafficking [BR:clu04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     CLUG_02994 Proteasome [BR:clu03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      CLUG_02994 DNA repair and recombination proteins [BR:clu03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      CLUG_02994 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DSS1_SEM1 Motif Other DBs NCBI-GeneID:  8498023 NCBI-ProteinID:  XP_002617550 UniProt:  C4Y381 LinkDB All DBs AA seq 68 aa AA seqDB search MSDKEEKIIKTLEEDDEFEDFPEDSHWSSEPNPHLNAANLWEEDWDDDDAKDDFSEKLRQ ELKRTQKN NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgtccgataaagaagaaaaaatcatcaagaccttggaggaagacgacgagtttgaggat tttcccgaagactcgcattggtcaagcgaacccaacccacacttgaatgcggccaacctc tgggaggaagattgggacgacgatgacgccaaagatgatttcagcgagaagttgcgccag gagttgaagcggacacagaagaattag

DBGET integrated database retrieval system