Clavispora lusitaniae ATCC 42720: CLUG_03902 Help Entry CLUG_03902        CDS       T01149                                  Name (RefSeq) cell division control protein 42   KO K04393   cell division control protein 42 Organism clu  Clavispora lusitaniae ATCC 42720 Pathway clu04011   MAPK signaling pathway - yeast clu04144   Endocytosis clu04517   IgSF CAM signaling clu04518   Integrin signaling clu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:clu00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     CLUG_03902   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     CLUG_03902    04518 Integrin signaling     CLUG_03902  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     CLUG_03902  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     CLUG_03902  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clu04131]     CLUG_03902    03036 Chromosome and associated proteins [BR:clu03036]     CLUG_03902   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clu04147]     CLUG_03902    04031 GTP-binding proteins [BR:clu04031]     CLUG_03902 Membrane trafficking [BR:clu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     CLUG_03902  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     CLUG_03902   Macropinocytosis    Ras GTPases     CLUG_03902 Chromosome and associated proteins [BR:clu03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     CLUG_03902 Exosome [BR:clu04147]  Exosomal proteins   Exosomal proteins of microglial cells    CLUG_03902   Exosomal proteins of breast milk    CLUG_03902 GTP-binding proteins [BR:clu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     CLUG_03902 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  8497191 NCBI-ProteinID:  XP_002616661 UniProt:  C4Y6W8 LinkDB All DBs AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTSKFPADYVPTVFDNYAVTVMIGDEPFTLGLFDTAG QEDYDRLRPLSYPSTDVFLVCFSVIAPASFENVKEKWFPEVHHHCPGVPCLIVGTQIDLR NDEVILQRLHRQKLSPITTDQGEKLAKELRAVKYVECSALTQRGLKTVFDEAIVAALEPP VIKKSKKCAIL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcaaaccataaagtgtgtcgttgttggagacggtgcggtcggaaaaacatgtttgttg atctcgtataccacttctaagtttcccgcagactatgttcctactgtttttgataactat gccgtgacggtaatgattggcgacgagcccttcaccttgggcctatttgacactgctggt caagaagattatgatagattgaggccgttgtcgtacccttctacagatgtttttttggtt tgtttttcggtgatagcacccgcttcgttcgagaacgtcaaagagaagtggttccccgag gtacaccaccactgtccaggtgtgccgtgccttatagtgggtacgcaaatcgacttgaga aatgacgaggtcattttgcagagattgcacagacaaaagttgtcacctataactactgat caaggagagaaattggccaaggagttgagggcagttaagtacgtggagtgctctgcatta acgcaaagaggattaaagacggtgtttgacgaggctattgttgctgccttggagccacca gtgatcaagaaatccaagaagtgcgctatattgtaa

DBGET integrated database retrieval system