Clavispora lusitaniae ATCC 42720: CLUG_04708 Help Entry CLUG_04708        CDS       T01149                                  Name (RefSeq) hypothetical protein   KO K11511   centromere protein S Organism clu  Clavispora lusitaniae ATCC 42720 Pathway clu03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:clu00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     CLUG_04708  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:clu03036]     CLUG_04708    03400 DNA repair and recombination proteins [BR:clu03400]     CLUG_04708 Chromosome and associated proteins [BR:clu03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      CLUG_04708 DNA repair and recombination proteins [BR:clu03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      CLUG_04708 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Chordopox_G2 Bromo_TP HA2_C TFIID-31kDa Amelotin Motif Other DBs NCBI-GeneID:  8496030 NCBI-ProteinID:  XP_002615826 UniProt:  C4Y931 LinkDB All DBs AA seq 114 aa AA seqDB search MSRCLLASRNLGCVSYTLTMAEDSATRLKASIYLSVAKAVEEKTAELKVAASPSFVASLV ELVFNQLVSVGEDLELFADHAGRSVVNSSDVYMVTRRNEILTAALKEYEKTLPK NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgtcgcgatgccttttggcttcaagaaatctaggttgcgtgtcgtacactcttaccatg gcagaagatagtgctactcggctcaaagcatccatctatttgagcgtagccaaggcggtt gaggaaaagacggccgagctcaaagtggcagcgagcccttctttcgtcgcgtctttggtc gagcttgtgttcaaccaacttgttagcgttggtgaggacttggagctctttgctgaccat gctgggcgctcggtggttaattcttctgacgtttacatggtgacacggcgaaacgagatt ttgactgctgcgctcaaagagtacgaaaagacgttgcccaagtaa

DBGET integrated database retrieval system