Clavispora lusitaniae ATCC 42720: CLUG_05175 Help Entry CLUG_05175        CDS       T01149                                  Name (RefSeq) hypothetical protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism clu  Clavispora lusitaniae ATCC 42720 Pathway clu03020   RNA polymerase clu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:clu00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     CLUG_05175   09124 Replication and repair    03420 Nucleotide excision repair     CLUG_05175  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:clu03021]     CLUG_05175    03400 DNA repair and recombination proteins [BR:clu03400]     CLUG_05175 Transcription machinery [BR:clu03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      CLUG_05175   RNA polymerase III system    RNA polymerase III      CLUG_05175   RNA polymerase I system    RNA polymerase I      CLUG_05175 DNA repair and recombination proteins [BR:clu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       CLUG_05175 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  8495371 NCBI-ProteinID:  XP_002615160 UniProt:  C4Y9V4 LinkDB All DBs AA seq 156 aa AA seqDB search MSDAEEAYNEAPENFEDFDAPDHFSDDEFADPDPVSHQNGNDAEMKAEDGRTIVHGGYSE ADAQVRVKTTKELAIPKEDRTTTPYMTKYERARVLGTRALQISLNAPVLVDIEGETDPLQ IAMKELAQRKIPLVIRRYLPDGSYEDWGCDELIIEN NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgtcggacgcggaggaagcttacaacgaggccccagaaaactttgaggatttcgatgct ccagaccatttttcagatgacgagtttgccgacccagacccagtctcccaccaaaacggc aatgatgccgaaatgaaagccgaagatggcagaaccatagtccatggcggctacagcgag gccgatgctcaagtaagagtgaaaacaacaaaggagttggcgatccccaaagaggacaga acaacgacaccatacatgaccaagtacgaaagggccagagtgttgggaacccgtgcattg cagatttctttgaatgcgcctgtgttggtggacatcgaaggtgaaaccgatcctttgcag atcgccatgaaggagttggcgcagagaaaaatccccttggtcatcagaagatacttgcct gacggatcgtacgaggactggggctgcgacgagttgattatcgaaaactaa

DBGET integrated database retrieval system