KEGG   Canis lupus dingo (dingo): 112640050
Entry
112640050         CDS       T08371                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
clud  Canis lupus dingo (dingo)
Pathway
clud01521  EGFR tyrosine kinase inhibitor resistance
clud01522  Endocrine resistance
clud01524  Platinum drug resistance
clud04010  MAPK signaling pathway
clud04012  ErbB signaling pathway
clud04014  Ras signaling pathway
clud04015  Rap1 signaling pathway
clud04022  cGMP-PKG signaling pathway
clud04024  cAMP signaling pathway
clud04062  Chemokine signaling pathway
clud04066  HIF-1 signaling pathway
clud04068  FoxO signaling pathway
clud04071  Sphingolipid signaling pathway
clud04072  Phospholipase D signaling pathway
clud04114  Oocyte meiosis
clud04140  Autophagy - animal
clud04148  Efferocytosis
clud04150  mTOR signaling pathway
clud04151  PI3K-Akt signaling pathway
clud04210  Apoptosis
clud04218  Cellular senescence
clud04261  Adrenergic signaling in cardiomyocytes
clud04270  Vascular smooth muscle contraction
clud04350  TGF-beta signaling pathway
clud04360  Axon guidance
clud04370  VEGF signaling pathway
clud04371  Apelin signaling pathway
clud04380  Osteoclast differentiation
clud04510  Focal adhesion
clud04520  Adherens junction
clud04540  Gap junction
clud04550  Signaling pathways regulating pluripotency of stem cells
clud04611  Platelet activation
clud04613  Neutrophil extracellular trap formation
clud04620  Toll-like receptor signaling pathway
clud04621  NOD-like receptor signaling pathway
clud04625  C-type lectin receptor signaling pathway
clud04650  Natural killer cell mediated cytotoxicity
clud04657  IL-17 signaling pathway
clud04658  Th1 and Th2 cell differentiation
clud04659  Th17 cell differentiation
clud04660  T cell receptor signaling pathway
clud04662  B cell receptor signaling pathway
clud04664  Fc epsilon RI signaling pathway
clud04666  Fc gamma R-mediated phagocytosis
clud04668  TNF signaling pathway
clud04713  Circadian entrainment
clud04720  Long-term potentiation
clud04722  Neurotrophin signaling pathway
clud04723  Retrograde endocannabinoid signaling
clud04724  Glutamatergic synapse
clud04725  Cholinergic synapse
clud04726  Serotonergic synapse
clud04730  Long-term depression
clud04810  Regulation of actin cytoskeleton
clud04910  Insulin signaling pathway
clud04912  GnRH signaling pathway
clud04914  Progesterone-mediated oocyte maturation
clud04915  Estrogen signaling pathway
clud04916  Melanogenesis
clud04917  Prolactin signaling pathway
clud04919  Thyroid hormone signaling pathway
clud04921  Oxytocin signaling pathway
clud04926  Relaxin signaling pathway
clud04928  Parathyroid hormone synthesis, secretion and action
clud04929  GnRH secretion
clud04930  Type II diabetes mellitus
clud04933  AGE-RAGE signaling pathway in diabetic complications
clud04934  Cushing syndrome
clud04935  Growth hormone synthesis, secretion and action
clud04960  Aldosterone-regulated sodium reabsorption
clud05010  Alzheimer disease
clud05020  Prion disease
clud05022  Pathways of neurodegeneration - multiple diseases
clud05034  Alcoholism
clud05132  Salmonella infection
clud05133  Pertussis
clud05135  Yersinia infection
clud05140  Leishmaniasis
clud05142  Chagas disease
clud05145  Toxoplasmosis
clud05152  Tuberculosis
clud05160  Hepatitis C
clud05161  Hepatitis B
clud05163  Human cytomegalovirus infection
clud05164  Influenza A
clud05165  Human papillomavirus infection
clud05166  Human T-cell leukemia virus 1 infection
clud05167  Kaposi sarcoma-associated herpesvirus infection
clud05170  Human immunodeficiency virus 1 infection
clud05171  Coronavirus disease - COVID-19
clud05200  Pathways in cancer
clud05203  Viral carcinogenesis
clud05205  Proteoglycans in cancer
clud05206  MicroRNAs in cancer
clud05207  Chemical carcinogenesis - receptor activation
clud05208  Chemical carcinogenesis - reactive oxygen species
clud05210  Colorectal cancer
clud05211  Renal cell carcinoma
clud05212  Pancreatic cancer
clud05213  Endometrial cancer
clud05214  Glioma
clud05215  Prostate cancer
clud05216  Thyroid cancer
clud05218  Melanoma
clud05219  Bladder cancer
clud05220  Chronic myeloid leukemia
clud05221  Acute myeloid leukemia
clud05223  Non-small cell lung cancer
clud05224  Breast cancer
clud05225  Hepatocellular carcinoma
clud05226  Gastric cancer
clud05230  Central carbon metabolism in cancer
clud05231  Choline metabolism in cancer
clud05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
clud05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:clud00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112640050 (MAPK3)
   04012 ErbB signaling pathway
    112640050 (MAPK3)
   04014 Ras signaling pathway
    112640050 (MAPK3)
   04015 Rap1 signaling pathway
    112640050 (MAPK3)
   04350 TGF-beta signaling pathway
    112640050 (MAPK3)
   04370 VEGF signaling pathway
    112640050 (MAPK3)
   04371 Apelin signaling pathway
    112640050 (MAPK3)
   04668 TNF signaling pathway
    112640050 (MAPK3)
   04066 HIF-1 signaling pathway
    112640050 (MAPK3)
   04068 FoxO signaling pathway
    112640050 (MAPK3)
   04072 Phospholipase D signaling pathway
    112640050 (MAPK3)
   04071 Sphingolipid signaling pathway
    112640050 (MAPK3)
   04024 cAMP signaling pathway
    112640050 (MAPK3)
   04022 cGMP-PKG signaling pathway
    112640050 (MAPK3)
   04151 PI3K-Akt signaling pathway
    112640050 (MAPK3)
   04150 mTOR signaling pathway
    112640050 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112640050 (MAPK3)
   04148 Efferocytosis
    112640050 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    112640050 (MAPK3)
   04210 Apoptosis
    112640050 (MAPK3)
   04218 Cellular senescence
    112640050 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112640050 (MAPK3)
   04520 Adherens junction
    112640050 (MAPK3)
   04540 Gap junction
    112640050 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    112640050 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112640050 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112640050 (MAPK3)
   04613 Neutrophil extracellular trap formation
    112640050 (MAPK3)
   04620 Toll-like receptor signaling pathway
    112640050 (MAPK3)
   04621 NOD-like receptor signaling pathway
    112640050 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    112640050 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    112640050 (MAPK3)
   04660 T cell receptor signaling pathway
    112640050 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    112640050 (MAPK3)
   04659 Th17 cell differentiation
    112640050 (MAPK3)
   04657 IL-17 signaling pathway
    112640050 (MAPK3)
   04662 B cell receptor signaling pathway
    112640050 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    112640050 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    112640050 (MAPK3)
   04062 Chemokine signaling pathway
    112640050 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112640050 (MAPK3)
   04929 GnRH secretion
    112640050 (MAPK3)
   04912 GnRH signaling pathway
    112640050 (MAPK3)
   04915 Estrogen signaling pathway
    112640050 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    112640050 (MAPK3)
   04917 Prolactin signaling pathway
    112640050 (MAPK3)
   04921 Oxytocin signaling pathway
    112640050 (MAPK3)
   04926 Relaxin signaling pathway
    112640050 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    112640050 (MAPK3)
   04919 Thyroid hormone signaling pathway
    112640050 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    112640050 (MAPK3)
   04916 Melanogenesis
    112640050 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112640050 (MAPK3)
   04270 Vascular smooth muscle contraction
    112640050 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112640050 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    112640050 (MAPK3)
   04725 Cholinergic synapse
    112640050 (MAPK3)
   04726 Serotonergic synapse
    112640050 (MAPK3)
   04720 Long-term potentiation
    112640050 (MAPK3)
   04730 Long-term depression
    112640050 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    112640050 (MAPK3)
   04722 Neurotrophin signaling pathway
    112640050 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    112640050 (MAPK3)
   04380 Osteoclast differentiation
    112640050 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112640050 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112640050 (MAPK3)
   05206 MicroRNAs in cancer
    112640050 (MAPK3)
   05205 Proteoglycans in cancer
    112640050 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    112640050 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    112640050 (MAPK3)
   05203 Viral carcinogenesis
    112640050 (MAPK3)
   05230 Central carbon metabolism in cancer
    112640050 (MAPK3)
   05231 Choline metabolism in cancer
    112640050 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112640050 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112640050 (MAPK3)
   05212 Pancreatic cancer
    112640050 (MAPK3)
   05225 Hepatocellular carcinoma
    112640050 (MAPK3)
   05226 Gastric cancer
    112640050 (MAPK3)
   05214 Glioma
    112640050 (MAPK3)
   05216 Thyroid cancer
    112640050 (MAPK3)
   05221 Acute myeloid leukemia
    112640050 (MAPK3)
   05220 Chronic myeloid leukemia
    112640050 (MAPK3)
   05218 Melanoma
    112640050 (MAPK3)
   05211 Renal cell carcinoma
    112640050 (MAPK3)
   05219 Bladder cancer
    112640050 (MAPK3)
   05215 Prostate cancer
    112640050 (MAPK3)
   05213 Endometrial cancer
    112640050 (MAPK3)
   05224 Breast cancer
    112640050 (MAPK3)
   05223 Non-small cell lung cancer
    112640050 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112640050 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    112640050 (MAPK3)
   05161 Hepatitis B
    112640050 (MAPK3)
   05160 Hepatitis C
    112640050 (MAPK3)
   05171 Coronavirus disease - COVID-19
    112640050 (MAPK3)
   05164 Influenza A
    112640050 (MAPK3)
   05163 Human cytomegalovirus infection
    112640050 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112640050 (MAPK3)
   05165 Human papillomavirus infection
    112640050 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112640050 (MAPK3)
   05135 Yersinia infection
    112640050 (MAPK3)
   05133 Pertussis
    112640050 (MAPK3)
   05152 Tuberculosis
    112640050 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112640050 (MAPK3)
   05140 Leishmaniasis
    112640050 (MAPK3)
   05142 Chagas disease
    112640050 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112640050 (MAPK3)
   05020 Prion disease
    112640050 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    112640050 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    112640050 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    112640050 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112640050 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112640050 (MAPK3)
   04934 Cushing syndrome
    112640050 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112640050 (MAPK3)
   01524 Platinum drug resistance
    112640050 (MAPK3)
   01522 Endocrine resistance
    112640050 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:clud01001]
    112640050 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:clud03036]
    112640050 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:clud04147]
    112640050 (MAPK3)
Enzymes [BR:clud01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112640050 (MAPK3)
Protein kinases [BR:clud01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112640050 (MAPK3)
Chromosome and associated proteins [BR:clud03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     112640050 (MAPK3)
Exosome [BR:clud04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112640050 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 112640050
NCBI-ProteinID: XP_025271541
Ensembl: ENSCAFG00020017614
UniProt: A0A8C0KYY7
LinkDB
Position
6:complement(17971414..17977897)
AA seq 380 aa
MAAAAAAQGGGGGEPRGADGVGPGVSGEVEVVKGQPFDVGPRYTELHYIGEGAYGMVSSA
YDHVRKVRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLDAMRDVY
IVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGVLEAP
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggctcaggggggcgggggcggggagccccggggagccgatggg
gtcggcccgggggtctcgggggaggtggaggtggtgaaggggcagccgttcgacgtgggc
ccgcgctacacggagctgcactacatcggcgagggcgcgtacggcatggtcagctcagct
tacgaccacgtgcgcaaggttcgcgtggccatcaagaaaatcagcccctttgagcatcag
acctactgccagcgcacactgagggagatccagatcttgctgcgcttccgccatgagaac
gtcattggcattcgggacattctgcgggcgcccaccctggacgccatgagggatgtctac
atcgtgcaggacctgatggagacagacctatacaagttgctcaaaagccagcagctgagc
aacgaccatgtttgctacttcctctaccagatcctgcgaggtctcaagtatatccactca
gccaatgtgctccaccgggatttaaagccctctaacctgctcatcaacaccacctgcgac
cttaagatctgcgattttggcctggcccggattgccgatcctgagcatgaccacactggc
ttcctgacagaatatgtggccacgcgctggtaccgggctccagaaatcatgcttaactct
aagggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctc
tccaaccggcccatcttccctggcaagcactacctggaccagctcaaccacattctaggt
atcctaggctctccatcccaggaggacttgaactgtatcatcaatatgaaggcccgaaac
tacctacagtctctgccctccaagaccaaggtggcatgggccaagctttttcccaagtca
gactccaaagcccttgacctgctagaccggatgttgacctttaaccccaacaaacggatt
acagtggaagaagcactggctcatccctacttggagcagtactacgacccaacagatgag
ccagtggctgaggagcctttcactttcgacatggagctggatgatctacccaaggagcgt
ctgaaggagctcatcttccaggagacagcccgcttccagcctggggtgctggaagccccc
tag

DBGET integrated database retrieval system