Canis lupus dingo (dingo): 112645140 Help Entry 112645140         CDS       T08371                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism clud  Canis lupus dingo (dingo) Pathway clud04010   MAPK signaling pathway clud04014   Ras signaling pathway clud04015   Rap1 signaling pathway clud04024   cAMP signaling pathway clud04072   Phospholipase D signaling pathway clud04137   Mitophagy - animal clud04140   Autophagy - animal clud04218   Cellular senescence clud04360   Axon guidance clud04371   Apelin signaling pathway clud04625   C-type lectin receptor signaling pathway clud04810   Regulation of actin cytoskeleton clud05132   Salmonella infection clud05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112645140 (RRAS)    04014 Ras signaling pathway     112645140 (RRAS)    04015 Rap1 signaling pathway     112645140 (RRAS)    04371 Apelin signaling pathway     112645140 (RRAS)    04072 Phospholipase D signaling pathway     112645140 (RRAS)    04024 cAMP signaling pathway     112645140 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112645140 (RRAS)    04137 Mitophagy - animal     112645140 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     112645140 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112645140 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112645140 (RRAS)   09158 Development and regeneration    04360 Axon guidance     112645140 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     112645140 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     112645140 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:clud04031]     112645140 (RRAS) GTP-binding proteins [BR:clud04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     112645140 (RRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Abhydrolase_4 Motif Other DBs NCBI-GeneID:  112645140 NCBI-ProteinID:  XP_025280029 Ensembl:  ENSCAFG00020024879 UniProt:  A0A8C0LLJ6 LinkDB All DBs Position 1:106943508..106947395 Genome browser AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGVPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPIVLVGNKADLETQRQVPRSEASAFGASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKDGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcggggggccgggg cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctactttgtgtctgactacgatccc accatcgaagactcctatacgaagatctgcacggtggatggtgtcccggcccggctcgac atcctggacaccgcaggccaggaggagttcggtgccatgcgggagcagtacatgcgcgct ggccacggcttcctgctggtgtttgctattaatgaccggcagagtttcaacgaggtgggc aagcttttcacgcagatcctccgagtcaaggaccgagacgatttccccatcgtgttggtt gggaacaaggctgatctggagacacagcgccaggtcccccgatctgaagcctctgccttt ggcgcctcccaccacgtggcctacttcgaggcctcagccaaactgcgcctcaatgtggac gaggcctttgagcagctggtgcgggctgtccggaagtaccaggagcaggagctcccgccc agcccacccagtgcccccaggaagaaagacggaggctgtccctgcgtcctcctctag

DBGET integrated database retrieval system