Canis lupus dingo (dingo): 112645189 Help Entry 112645189         CDS       T08371                                  Symbol FGF21 Name (RefSeq) fibroblast growth factor 21   KO K22429   fibroblast growth factor 21 Organism clud  Canis lupus dingo (dingo) Pathway clud04010   MAPK signaling pathway clud04014   Ras signaling pathway clud04015   Rap1 signaling pathway clud04020   Calcium signaling pathway clud04151   PI3K-Akt signaling pathway clud04714   Thermogenesis clud04810   Regulation of actin cytoskeleton clud05200   Pathways in cancer clud05218   Melanoma clud05224   Breast cancer clud05226   Gastric cancer Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112645189 (FGF21)    04014 Ras signaling pathway     112645189 (FGF21)    04015 Rap1 signaling pathway     112645189 (FGF21)    04020 Calcium signaling pathway     112645189 (FGF21)    04151 PI3K-Akt signaling pathway     112645189 (FGF21)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112645189 (FGF21)  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     112645189 (FGF21)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112645189 (FGF21)   09162 Cancer: specific types    05226 Gastric cancer     112645189 (FGF21)    05218 Melanoma     112645189 (FGF21)    05224 Breast cancer     112645189 (FGF21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clud04052]     112645189 (FGF21)    00536 Glycosaminoglycan binding proteins [BR:clud00536]     112645189 (FGF21) Cytokines and neuropeptides [BR:clud04052]  Cytokines   Growth factors (RTK binding)    112645189 (FGF21) Glycosaminoglycan binding proteins [BR:clud00536]  Heparan sulfate / Heparin   Growth factors/receptors    112645189 (FGF21) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  112645189 NCBI-ProteinID:  XP_035567837 Ensembl:  ENSCAFG00020026328 UniProt:  A0A8C0LL57 LinkDB All DBs Position 1:complement(107618879..107620970) Genome browser AA seq 209 aa AA seqDB search MGWAEAGFEHLGLWVPVLAVLLLEACRAHPIPDSSPLLQFGGQVRQRYLYTDDAQETEAH LEIRADGTVVGAARQSPESLLELKALKPGVIQILGVKTSRFLCQGPDGTLYGSLHFDPVA CSFRELLLEDGYNIYHSETLGLPLRLRPHNSAYRDLAPRGPARFLPLPGLLPAPPEPPGI LAPEPPDVGSSDPLSMVGPSQGRSPSYAS NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atgggctgggccgaggccgggttcgagcacctgggactgtgggtccctgtgctggctgtg cttttgctggaagcctgccgggcacatccgatccctgactccagccccctcctacaattt ggaggtcaagttcgacagcggtacctctacaccgacgatgcccaggagacagaggcccac ctagagatcagggccgatggcacagtggtgggggctgcccgccagagccctgaaagtctc ctggagctgaaagccctaaagccaggggtcattcaaatcttgggagtcaaaacatccagg ttcctgtgccagggcccagatgggacactatatggctcgctccatttcgaccctgtggcc tgcagtttccgagaactgcttcttgaggatgggtacaacatctaccactccgagaccctt ggtctcccgcttcgcctgcgcccccacaactccgcataccgggacttggcaccccgcggg cctgcccgcttcctgccactgccaggcctgcttccagcacccccagagcctccagggatc ctggccccggagcctcctgacgtgggctcctcggaccctctgagcatggtggggccttca cagggccggagtcccagctatgcttcctaa

DBGET integrated database retrieval system