KEGG   Canis lupus dingo (dingo): 112646563
Entry
112646563         CDS       T08371                                 
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
  KO
K03038  26S proteasome regulatory subunit N8
Organism
clud  Canis lupus dingo (dingo)
Pathway
clud03050  Proteasome
clud05010  Alzheimer disease
clud05012  Parkinson disease
clud05014  Amyotrophic lateral sclerosis
clud05016  Huntington disease
clud05017  Spinocerebellar ataxia
clud05020  Prion disease
clud05022  Pathways of neurodegeneration - multiple diseases
clud05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:clud00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    112646563 (PSMD7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    112646563 (PSMD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112646563 (PSMD7)
   05012 Parkinson disease
    112646563 (PSMD7)
   05014 Amyotrophic lateral sclerosis
    112646563 (PSMD7)
   05016 Huntington disease
    112646563 (PSMD7)
   05017 Spinocerebellar ataxia
    112646563 (PSMD7)
   05020 Prion disease
    112646563 (PSMD7)
   05022 Pathways of neurodegeneration - multiple diseases
    112646563 (PSMD7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:clud03051]
    112646563 (PSMD7)
Proteasome [BR:clud03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     112646563 (PSMD7)
SSDB
Motif
Pfam: MitMem_reg JAB Connexin Coilin_N
Other DBs
NCBI-GeneID: 112646563
NCBI-ProteinID: XP_025282479
Ensembl: ENSCAFG00020020315
UniProt: A0A8C0L401
LinkDB
Position
5:79777451..79786131
AA seq 324 aa
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDR
KDDKEKEKEKEKGDSKKEEKKEKK
NT seq 975 nt   +upstreamnt  +downstreamnt
atgccggagctggcggtgcagaaggtggtcgttcaccccctggtgctgctcagtgtggtg
gatcacttcaaccgaataggcaaggttggaaaccagaagcgcgttgtcggtgtgcttttg
gggtcatggcaaaagaaggtactcgacgtatccaacagttttgcagtcccttttgatgaa
gatgacaaagatgattctgtctggtttttagaccatgattatttggaaaacatgtatgga
atgtttaagaaggtcaatgccagagaaagaatagttgggtggtaccacacaggccctaaa
ctacacaagaatgacatcgccattaacgaactcatgaaaagatactgccctaactcagta
ctggtcatcattgatgtgaagccaaaggacctgggactgcccacagaagcatatatttca
gtggaagaagtccatgatgatggaacgccaacctcaaaaacatttgagcatgtgaccagt
gagattggagcggaggaagccgaggaagttggagtcgagcacttgttacgagacatcaaa
gacactacggtgggcactctttcacagaggattacaaaccaggtccatggtttgaaggga
ctaaactccaagcttctggacatcaggagctacctggagaaagtggccacgggcaagctg
cccatcaaccatcagatcatctaccagctacaggatgtcttcaacctgctgccggacgtc
agcctccaggagtttgtcaaggccttttacctgaagaccaatgaccagatggtagtggtg
tacttggcttcactgatccgttctgtggtcgccctgcacaacctcatcaacaacaagatc
gccaaccgtgatgcagagaagaaagaagggcaggaaaaagaagagagcaaaaaggataga
aaagatgacaaagagaaggagaaggagaaggaaaagggtgacagcaagaaagaagagaaa
aaggagaaaaaataa

DBGET integrated database retrieval system