Canis lupus dingo (dingo): 112646563
Help
Entry
112646563 CDS
T08371
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
KO
K03038
26S proteasome regulatory subunit N8
Organism
clud
Canis lupus dingo (dingo)
Pathway
clud03050
Proteasome
clud05010
Alzheimer disease
clud05012
Parkinson disease
clud05014
Amyotrophic lateral sclerosis
clud05016
Huntington disease
clud05017
Spinocerebellar ataxia
clud05020
Prion disease
clud05022
Pathways of neurodegeneration - multiple diseases
clud05169
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:
clud00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
112646563 (PSMD7)
09160 Human Diseases
09172 Infectious disease: viral
05169 Epstein-Barr virus infection
112646563 (PSMD7)
09164 Neurodegenerative disease
05010 Alzheimer disease
112646563 (PSMD7)
05012 Parkinson disease
112646563 (PSMD7)
05014 Amyotrophic lateral sclerosis
112646563 (PSMD7)
05016 Huntington disease
112646563 (PSMD7)
05017 Spinocerebellar ataxia
112646563 (PSMD7)
05020 Prion disease
112646563 (PSMD7)
05022 Pathways of neurodegeneration - multiple diseases
112646563 (PSMD7)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
clud03051
]
112646563 (PSMD7)
Proteasome [BR:
clud03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
112646563 (PSMD7)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MitMem_reg
JAB
Connexin
Coilin_N
Motif
Other DBs
NCBI-GeneID:
112646563
NCBI-ProteinID:
XP_025282479
Ensembl:
ENSCAFG00020020315
UniProt:
A0A8C0L401
LinkDB
All DBs
Position
5:79777451..79786131
Genome browser
AA seq
324 aa
AA seq
DB search
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDR
KDDKEKEKEKEKGDSKKEEKKEKK
NT seq
975 nt
NT seq
+upstream
nt +downstream
nt
atgccggagctggcggtgcagaaggtggtcgttcaccccctggtgctgctcagtgtggtg
gatcacttcaaccgaataggcaaggttggaaaccagaagcgcgttgtcggtgtgcttttg
gggtcatggcaaaagaaggtactcgacgtatccaacagttttgcagtcccttttgatgaa
gatgacaaagatgattctgtctggtttttagaccatgattatttggaaaacatgtatgga
atgtttaagaaggtcaatgccagagaaagaatagttgggtggtaccacacaggccctaaa
ctacacaagaatgacatcgccattaacgaactcatgaaaagatactgccctaactcagta
ctggtcatcattgatgtgaagccaaaggacctgggactgcccacagaagcatatatttca
gtggaagaagtccatgatgatggaacgccaacctcaaaaacatttgagcatgtgaccagt
gagattggagcggaggaagccgaggaagttggagtcgagcacttgttacgagacatcaaa
gacactacggtgggcactctttcacagaggattacaaaccaggtccatggtttgaaggga
ctaaactccaagcttctggacatcaggagctacctggagaaagtggccacgggcaagctg
cccatcaaccatcagatcatctaccagctacaggatgtcttcaacctgctgccggacgtc
agcctccaggagtttgtcaaggccttttacctgaagaccaatgaccagatggtagtggtg
tacttggcttcactgatccgttctgtggtcgccctgcacaacctcatcaacaacaagatc
gccaaccgtgatgcagagaagaaagaagggcaggaaaaagaagagagcaaaaaggataga
aaagatgacaaagagaaggagaaggagaaggaaaagggtgacagcaagaaagaagagaaa
aaggagaaaaaataa
DBGET
integrated database retrieval system