Canis lupus dingo (dingo): 112647626 Help Entry 112647626         CDS       T08371                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism clud  Canis lupus dingo (dingo) Brite KEGG Orthology (KO) [BR:clud00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:clud03041]     112647626   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clud04052]     112647626 Spliceosome [BR:clud03041]  Complex B   Other components    Complex B specific factors     112647626 Cytokines and neuropeptides [BR:clud04052]  Neuropeptides   Unclassified    112647626 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  112647626 NCBI-ProteinID:  XP_025284571 Ensembl:  ENSCAFG00020000359 UniProt:  A0A8C0JJ81 LinkDB All DBs Position 5:38871386..38871806 Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVRCNTDDTIGDLKKLIAAQTGTRWNKIILKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccgtctagggaagaaggtccgcgttaggtgcaacact gatgacaccatcggggaccttaagaagctgatcgcagcccaaactggcacccgttggaac aagatcatcctgaagaagtggtacacgattttcaaggaccacgtgtctctgggggactat gaaatccacgatgggatgaacctagagctttattaccaatag

DBGET integrated database retrieval system