Canis lupus dingo (dingo): 112649991 Help Entry 112649991         CDS       T08371                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism clud  Canis lupus dingo (dingo) Pathway clud04621   NOD-like receptor signaling pathway clud05012   Parkinson disease clud05132   Salmonella infection clud05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     112649991 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112649991 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     112649991 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     112649991 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:clud03110]     112649991 (TXN) Chaperones and folding catalysts [BR:clud03110]  Protein folding catalysts   Protein disulfide isomerase    112649991 (TXN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  112649991 NCBI-ProteinID:  XP_025288383 LinkDB All DBs Position 11:complement(64743165..64756440) Genome browser AA seq 105 aa AA seqDB search MVKQIESKYAFQEALNSAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaagtatgcttttcaggaagccttgaacagtgctggggat aaacttgtagtagttgacttctcagccacgtggtgtggaccttgcaaaatgatcaagcct ttctttcattccctctctgagaagtattctaacgtggtgttccttgaagtagatgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccgaccttccagtttttt aagaagggacaaaaggtgggtgaattttccggagctaataaggaaaaacttgaagccacc ataaatgaattaatctaa

DBGET integrated database retrieval system