Canis lupus dingo (dingo): 112650031 Help Entry 112650031         CDS       T08371                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism clud  Canis lupus dingo (dingo) Pathway clud04010   MAPK signaling pathway clud04020   Calcium signaling pathway clud04022   cGMP-PKG signaling pathway clud04114   Oocyte meiosis clud04218   Cellular senescence clud04310   Wnt signaling pathway clud04360   Axon guidance clud04370   VEGF signaling pathway clud04380   Osteoclast differentiation clud04625   C-type lectin receptor signaling pathway clud04650   Natural killer cell mediated cytotoxicity clud04658   Th1 and Th2 cell differentiation clud04659   Th17 cell differentiation clud04660   T cell receptor signaling pathway clud04662   B cell receptor signaling pathway clud04720   Long-term potentiation clud04724   Glutamatergic synapse clud04921   Oxytocin signaling pathway clud04922   Glucagon signaling pathway clud04924   Renin secretion clud05010   Alzheimer disease clud05014   Amyotrophic lateral sclerosis clud05020   Prion disease clud05022   Pathways of neurodegeneration - multiple diseases clud05031   Amphetamine addiction clud05152   Tuberculosis clud05163   Human cytomegalovirus infection clud05166   Human T-cell leukemia virus 1 infection clud05167   Kaposi sarcoma-associated herpesvirus infection clud05170   Human immunodeficiency virus 1 infection clud05235   PD-L1 expression and PD-1 checkpoint pathway in cancer clud05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112650031 (PPP3R2)    04310 Wnt signaling pathway     112650031 (PPP3R2)    04370 VEGF signaling pathway     112650031 (PPP3R2)    04020 Calcium signaling pathway     112650031 (PPP3R2)    04022 cGMP-PKG signaling pathway     112650031 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     112650031 (PPP3R2)    04218 Cellular senescence     112650031 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112650031 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     112650031 (PPP3R2)    04660 T cell receptor signaling pathway     112650031 (PPP3R2)    04658 Th1 and Th2 cell differentiation     112650031 (PPP3R2)    04659 Th17 cell differentiation     112650031 (PPP3R2)    04662 B cell receptor signaling pathway     112650031 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     112650031 (PPP3R2)    04921 Oxytocin signaling pathway     112650031 (PPP3R2)    04924 Renin secretion     112650031 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     112650031 (PPP3R2)    04720 Long-term potentiation     112650031 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     112650031 (PPP3R2)    04380 Osteoclast differentiation     112650031 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112650031 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112650031 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     112650031 (PPP3R2)    05163 Human cytomegalovirus infection     112650031 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     112650031 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     112650031 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     112650031 (PPP3R2)    05014 Amyotrophic lateral sclerosis     112650031 (PPP3R2)    05020 Prion disease     112650031 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     112650031 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     112650031 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112650031 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:clud01009]     112650031 (PPP3R2) Protein phosphatases and associated proteins [BR:clud01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      112650031 (PPP3R2) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF_SSP120 EF-hand_FSTL1 SPARC_Ca_bdg EH EF-hand_9 USP32_N flgK_1st_1 Motif Other DBs NCBI-GeneID:  112650031 NCBI-ProteinID:  XP_025288440 LinkDB All DBs Position 11 Genome browser AA seq 175 aa AA seqDB search MPACTMGNEASYPEEMCSHFSQDEIKRLGKRFKKLDLDCSGSLSVDEFLSLPELQQNPLV QRVVDVFDTDGNGEVDFREFILGASQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQV LKMMVRDNLKDWQLQQLVDKTIITLDRDGDGKISFEEFSAVVGGLEVHKKLVVIV NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atgcccgcgtgcacaatggggaacgaagccagttaccccgaggagatgtgctcccacttc agccaggacgaaattaagaggctgggcaagcggttcaagaagctggacctggactgctcg ggctccctgagcgtggacgagttcctgtcgctgcccgagctgcagcagaacccgctggtg cagcgagtggtcgacgtcttcgacacggacggcaacggagaggtggacttcagggagttc atcctgggggcctcccagttcagcgtcaggggggacgaggagcagaagctgaggtttgcc ttcagcatctacgacatggataaagacggctacatctccaacggggagctgttccaggtg ctgaagatgatggtccgggacaacctgaaagactggcagttacagcagctggtggacaag accatcatcaccctggatagagacggggacgggaagatctccttcgaggagttcagtgct gtggtcggaggcctggaggtgcacaagaagctggtagtaattgtgtga

DBGET integrated database retrieval system