Canis lupus dingo (dingo): 112650509 Help Entry 112650509         CDS       T08371                                  Name (RefSeq) interferon alpha-1/2-like   KO K05414   interferon alpha Organism clud  Canis lupus dingo (dingo) Pathway clud04060   Cytokine-cytokine receptor interaction clud04151   PI3K-Akt signaling pathway clud04217   Necroptosis clud04620   Toll-like receptor signaling pathway clud04621   NOD-like receptor signaling pathway clud04622   RIG-I-like receptor signaling pathway clud04623   Cytosolic DNA-sensing pathway clud04630   JAK-STAT signaling pathway clud04650   Natural killer cell mediated cytotoxicity clud04936   Alcoholic liver disease clud05152   Tuberculosis clud05160   Hepatitis C clud05161   Hepatitis B clud05162   Measles clud05163   Human cytomegalovirus infection clud05164   Influenza A clud05165   Human papillomavirus infection clud05167   Kaposi sarcoma-associated herpesvirus infection clud05168   Herpes simplex virus 1 infection clud05169   Epstein-Barr virus infection clud05170   Human immunodeficiency virus 1 infection clud05171   Coronavirus disease - COVID-19 clud05200   Pathways in cancer clud05320   Autoimmune thyroid disease clud05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112650509    04151 PI3K-Akt signaling pathway     112650509   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112650509  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112650509  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112650509    04621 NOD-like receptor signaling pathway     112650509    04622 RIG-I-like receptor signaling pathway     112650509    04623 Cytosolic DNA-sensing pathway     112650509    04650 Natural killer cell mediated cytotoxicity     112650509  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112650509   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112650509    05161 Hepatitis B     112650509    05160 Hepatitis C     112650509    05171 Coronavirus disease - COVID-19     112650509    05164 Influenza A     112650509    05162 Measles     112650509    05168 Herpes simplex virus 1 infection     112650509    05163 Human cytomegalovirus infection     112650509    05167 Kaposi sarcoma-associated herpesvirus infection     112650509    05169 Epstein-Barr virus infection     112650509    05165 Human papillomavirus infection     112650509   09171 Infectious disease: bacterial    05152 Tuberculosis     112650509   09163 Immune disease    05320 Autoimmune thyroid disease     112650509   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112650509   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112650509  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clud04052]     112650509 Cytokines and neuropeptides [BR:clud04052]  Cytokines   Interferons    112650509 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  112650509 NCBI-ProteinID:  XP_025289049 Ensembl:  ENSCAFG00020013776 UniProt:  A0A8C0KM01 LinkDB All DBs Position 11:40312194..40312864 Genome browser AA seq 187 aa AA seqDB search MALPCSFSVALVLLSCHSLCCLACHLPDTHGLRNWRVLTLLGQMRRLSAGSCDHYTNDFA FPKELFDGQRLQEVQALSVVHVMTQKVFHLFCPDTSSAPWNMTLLEELCSGLSEQLDDLE ACPLQEAGLAETPLMHEDSTLRTYFQRISLYLQDRNHSPCAWEMVRAEIGRSFFSSTILQ ERIRRKE NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccctgccctgctccttctcggtggccctggtgctgctcagctgccactccctgtgc tgtctggcttgccacctgcccgacacccacggcctgcgcaactggagggtcctgacgctc ctgggacagatgaggagactctctgccggctcttgtgaccactacaccaatgactttgcc ttccccaaggagctgtttgatggccagcggctccaggaggtgcaggccctctctgtggtc cacgtgatgacccagaaggtcttccacctcttctgcccggacacatcctctgctccttgg aacatgactctcctggaggaactgtgctcggggctctctgagcagctggatgacctggag gcctgtcccctgcaggaggcggggctggccgagacccccctcatgcatgaggactccacc ctgaggacctacttccaaaggatctccctctacctgcaagacaggaaccacagcccgtgt gcctgggagatggtccgagcagaaatcgggagatccttcttctcctcgacaatcttgcaa gaaagaatcaggaggaaggaatga

DBGET integrated database retrieval system