Canis lupus dingo (dingo): 112650687 Help Entry 112650687         CDS       T08371                                  Name (RefSeq) peroxiredoxin-1-like   KO K13279   peroxiredoxin 1 [EC:1.11.1.24] Organism clud  Canis lupus dingo (dingo) Pathway clud04146   Peroxisome clud04980   Cobalamin transport and metabolism clud05146   Amoebiasis Brite KEGG Orthology (KO) [BR:clud00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     112650687  09150 Organismal Systems   09154 Digestive system    04980 Cobalamin transport and metabolism     112650687  09160 Human Diseases   09174 Infectious disease: parasitic    05146 Amoebiasis     112650687  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clud04147]     112650687 Enzymes [BR:clud01000]  1. Oxidoreductases   1.11  Acting on a peroxide as acceptor    1.11.1  Peroxidases     1.11.1.24  thioredoxin-dependent peroxiredoxin      112650687 Exosome [BR:clud04147]  Exosomal proteins   Proteins found in most exosomes    112650687 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  1-cysPrx_C AhpC-TSA Redoxin Motif Other DBs NCBI-GeneID:  112650687 NCBI-ProteinID:  XP_035564139 LinkDB All DBs Position 29:complement(29179647..29180349) Genome browser AA seq 100 aa AA seqDB search MNIPLVSDPKRTIAQDYGVLKVDEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRL VQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaacattcccttggtatcagaccccaagcgtaccattgctcaggactatggagtctta aaggttgatgaaggcatctcgttcaggggcctctttattattgatgataaaggtatcctt cggcagatcactgtaaatgaccttcctgttggtcgctctgtggatgagactctgcgacta gttcaggccttccagtttactgacaagcatggggaagtgtgcccagctggctggaagcct ggcagtgataccatcaagcctgatgtccagaagagcaaagaatacttctctaagcagaag tga

DBGET integrated database retrieval system