Canis lupus dingo (dingo): 112651366 Help Entry 112651366         CDS       T08371                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism clud  Canis lupus dingo (dingo) Pathway clud04015   Rap1 signaling pathway clud04810   Regulation of actin cytoskeleton clud05014   Amyotrophic lateral sclerosis clud05132   Salmonella infection Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     112651366 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112651366 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112651366 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     112651366 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clud04131]     112651366 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:clud04812]     112651366 (PFN3)    04147 Exosome [BR:clud04147]     112651366 (PFN3) Membrane trafficking [BR:clud04131]  Others   Actin-binding proteins    Others     112651366 (PFN3) Cytoskeleton proteins [BR:clud04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      112651366 (PFN3) Exosome [BR:clud04147]  Exosomal proteins   Proteins found in most exosomes    112651366 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  112651366 NCBI-ProteinID:  XP_025290334 Ensembl:  ENSCAFG00020011917 UniProt:  A0A8C0QZD8 LinkDB All DBs Position 4:36353469..36354113 Genome browser AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRRTFL QAGLSIAGRRCCVLRDHLLSEGDGVLDARTKGLDGRAICVGHTPRVLLVLMGRRGAHGGI LNKTAHELINGLRTQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggagactggaaaggctatatcagcgcagtgctccgggaccagcgtattgacgacgtg gccatcgtgggccactcggacaatcgctgcgtgtgggcatcacgccctggcggccttctg gctgccatatccccgcaggaggtgggtgtgctcacagggcccgaccgccgcactttcctg caggcaggtctgagcattgcaggccgccgctgctgcgtcctccgtgaccacttgctgtct gagggcgatggcgttctggacgcacgcactaaggggctggatgggcgcgccatctgcgta ggccacaccccgcgcgtgctccttgtgcttatgggccgtcgtggcgcgcacggcggcatc ctcaataagacagcgcatgaactgatcaacgggctccgcacgcagggcacctag

DBGET integrated database retrieval system