Canis lupus dingo (dingo): 112652570 Help Entry 112652570         CDS       T08371                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism clud  Canis lupus dingo (dingo) Pathway clud04015   Rap1 signaling pathway clud04810   Regulation of actin cytoskeleton clud05014   Amyotrophic lateral sclerosis clud05132   Salmonella infection Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     112652570 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112652570 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112652570 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     112652570 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clud04131]     112652570 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:clud04812]     112652570 (PFN2)    04147 Exosome [BR:clud04147]     112652570 (PFN2) Membrane trafficking [BR:clud04131]  Others   Actin-binding proteins    Others     112652570 (PFN2) Cytoskeleton proteins [BR:clud04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      112652570 (PFN2) Exosome [BR:clud04147]  Exosomal proteins   Proteins found in most exosomes    112652570 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  112652570 NCBI-ProteinID:  XP_025291965 Ensembl:  ENSCAFG00020004478 LinkDB All DBs Position 23:complement(44752885..44758785) Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcatcacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtc gacggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system