Canis lupus dingo (dingo): 112653087 Help Entry 112653087         CDS       T08371                                  Name (RefSeq) glutathione S-transferase P-like   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism clud  Canis lupus dingo (dingo) Pathway clud00480   Glutathione metabolism clud00980   Metabolism of xenobiotics by cytochrome P450 clud00982   Drug metabolism - cytochrome P450 clud00983   Drug metabolism - other enzymes clud01100   Metabolic pathways clud01524   Platinum drug resistance clud05200   Pathways in cancer clud05204   Chemical carcinogenesis - DNA adducts clud05215   Prostate cancer clud05225   Hepatocellular carcinoma clud05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     112653087   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     112653087    00982 Drug metabolism - cytochrome P450     112653087    00983 Drug metabolism - other enzymes     112653087  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112653087    05204 Chemical carcinogenesis - DNA adducts     112653087   09162 Cancer: specific types    05225 Hepatocellular carcinoma     112653087    05215 Prostate cancer     112653087   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     112653087   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     112653087  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:clud02000]     112653087 Enzymes [BR:clud01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      112653087 Transporters [BR:clud02000]  Other transporters   Pores ion channels [TC:1]    112653087 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_N_2 GST_C_2 GST_N_3 Motif Other DBs NCBI-GeneID:  112653087 NCBI-ProteinID:  XP_035567220 LinkDB All DBs Position X:10579853..10580631 Genome browser AA seq 210 aa AA seqDB search MPPYTITYFPVRGRCEAMRMLLADQGQSWKEEVVTMETWMKGSLKASCLYGQLPKFQDGD LTLYQSNAILRHLGRSLGLYGKDQQEAALLDVVNDGVEDLRCKYALLIYTNYEAGKEEYV KALPGYLKPFETLLSQNEGGQAFIVGNQISFADYNLLDLLLIHQVLAPSCLDSFPLLSAY VVRLSARPKLKAFLSSPEHVNRPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccaccctacaccatcacctacttccctgttcgagggcgctgtgaggccatgcgcatg ctgctggctgaccagggccagagctggaaggaggaggtggtgaccatggagacctggatg aagggctcactcaaggcctcctgtctgtacgggcagctccccaagttccaggacggagac ctcaccctgtaccagtccaatgccatcctgcgacacctgggccgctcccttgggctctac gggaaggaccagcaggaggcggccttgctggatgtagtgaacgatggtgtggaggatctc cgctgcaaatacgccctcctcatctacactaactatgaggcaggaaaggaggagtatgtg aaggcactaccaggttacctgaagccttttgaaacgctgttgtcccagaatgaggggggc caggccttcatcgtgggcaaccagatctccttcgcggactacaacctgctggacttgctg ctgattcaccaggtcctggcccccagctgcctggactccttccccctgctctcggcctat gtggtgcgcctcagcgccagacccaagctcaaggcattcctgtcgtcccccgagcacgtg aaccgccccatcaatggcaacgggaagcagtga

DBGET integrated database retrieval system