Canis lupus dingo (dingo): 112655372 Help Entry 112655372         CDS       T08371                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism clud  Canis lupus dingo (dingo) Pathway clud04060   Cytokine-cytokine receptor interaction clud04061   Viral protein interaction with cytokine and cytokine receptor clud04062   Chemokine signaling pathway clud04620   Toll-like receptor signaling pathway clud05142   Chagas disease clud05163   Human cytomegalovirus infection clud05323   Rheumatoid arthritis clud05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112655372    04061 Viral protein interaction with cytokine and cytokine receptor     112655372  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112655372    04062 Chemokine signaling pathway     112655372  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     112655372   09174 Infectious disease: parasitic    05142 Chagas disease     112655372   09163 Immune disease    05323 Rheumatoid arthritis     112655372   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112655372  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clud04052]     112655372    00536 Glycosaminoglycan binding proteins [BR:clud00536]     112655372 Cytokines and neuropeptides [BR:clud04052]  Cytokines   Chemokines    112655372 Glycosaminoglycan binding proteins [BR:clud00536]  Heparan sulfate / Heparin   Chemokines    112655372 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 DUF6211 Motif Other DBs NCBI-GeneID:  112655372 NCBI-ProteinID:  XP_025296248 Ensembl:  ENSCAFG00020003957 UniProt:  A0A8C0JR28 LinkDB All DBs Position 9:complement(38900517..38903546) Genome browser AA seq 93 aa AA seqDB search MEVSTAALAVLLLIAALCSQTCSSTFGADTPTSCCFSYISRQIPRKFVVDYYETSSQCSK PGVIFQTKRGQQICADPGKAWVQKYITNLELNA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaggtctccacggctgccctggctgtcctgcttctcatcgctgcgctctgttcccag acctgctcttccacttttggtgctgacactccgacctcctgctgcttctcctatatctcc cggcagattcctcgaaaatttgtggtggactattatgagaccagcagccagtgctccaag cccggtgtcatcttccaaaccaaaagaggccagcagatctgtgctgaccccgggaaggcc tgggtccagaagtatatcaccaacttggagctgaatgcctga

DBGET integrated database retrieval system