Canis lupus dingo (dingo): 112655674 Help Entry 112655674         CDS       T08371                                  Name (RefSeq) calmodulin-1-like   KO K02183   calmodulin Organism clud  Canis lupus dingo (dingo) Pathway clud04014   Ras signaling pathway clud04015   Rap1 signaling pathway clud04020   Calcium signaling pathway clud04022   cGMP-PKG signaling pathway clud04024   cAMP signaling pathway clud04070   Phosphatidylinositol signaling system clud04114   Oocyte meiosis clud04218   Cellular senescence clud04261   Adrenergic signaling in cardiomyocytes clud04270   Vascular smooth muscle contraction clud04371   Apelin signaling pathway clud04625   C-type lectin receptor signaling pathway clud04713   Circadian entrainment clud04720   Long-term potentiation clud04722   Neurotrophin signaling pathway clud04728   Dopaminergic synapse clud04740   Olfactory transduction clud04744   Phototransduction clud04750   Inflammatory mediator regulation of TRP channels clud04910   Insulin signaling pathway clud04912   GnRH signaling pathway clud04915   Estrogen signaling pathway clud04916   Melanogenesis clud04921   Oxytocin signaling pathway clud04922   Glucagon signaling pathway clud04924   Renin secretion clud04925   Aldosterone synthesis and secretion clud04970   Salivary secretion clud04971   Gastric acid secretion clud05010   Alzheimer disease clud05012   Parkinson disease clud05022   Pathways of neurodegeneration - multiple diseases clud05031   Amphetamine addiction clud05034   Alcoholism clud05133   Pertussis clud05152   Tuberculosis clud05163   Human cytomegalovirus infection clud05167   Kaposi sarcoma-associated herpesvirus infection clud05170   Human immunodeficiency virus 1 infection clud05200   Pathways in cancer clud05214   Glioma clud05417   Lipid and atherosclerosis clud05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     112655674    04015 Rap1 signaling pathway     112655674    04371 Apelin signaling pathway     112655674    04020 Calcium signaling pathway     112655674    04070 Phosphatidylinositol signaling system     112655674    04024 cAMP signaling pathway     112655674    04022 cGMP-PKG signaling pathway     112655674  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     112655674    04218 Cellular senescence     112655674  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112655674   09152 Endocrine system    04910 Insulin signaling pathway     112655674    04922 Glucagon signaling pathway     112655674    04912 GnRH signaling pathway     112655674    04915 Estrogen signaling pathway     112655674    04921 Oxytocin signaling pathway     112655674    04916 Melanogenesis     112655674    04924 Renin secretion     112655674    04925 Aldosterone synthesis and secretion     112655674   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     112655674    04270 Vascular smooth muscle contraction     112655674   09154 Digestive system    04970 Salivary secretion     112655674    04971 Gastric acid secretion     112655674   09156 Nervous system    04728 Dopaminergic synapse     112655674    04720 Long-term potentiation     112655674    04722 Neurotrophin signaling pathway     112655674   09157 Sensory system    04744 Phototransduction     112655674    04740 Olfactory transduction     112655674    04750 Inflammatory mediator regulation of TRP channels     112655674   09159 Environmental adaptation    04713 Circadian entrainment     112655674  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112655674   09162 Cancer: specific types    05214 Glioma     112655674   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112655674    05163 Human cytomegalovirus infection     112655674    05167 Kaposi sarcoma-associated herpesvirus infection     112655674   09171 Infectious disease: bacterial    05133 Pertussis     112655674    05152 Tuberculosis     112655674   09164 Neurodegenerative disease    05010 Alzheimer disease     112655674    05012 Parkinson disease     112655674    05022 Pathways of neurodegeneration - multiple diseases     112655674   09165 Substance dependence    05031 Amphetamine addiction     112655674    05034 Alcoholism     112655674   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112655674    05418 Fluid shear stress and atherosclerosis     112655674  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:clud01009]     112655674   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clud04131]     112655674    03036 Chromosome and associated proteins [BR:clud03036]     112655674   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clud04147]     112655674 Protein phosphatases and associated proteins [BR:clud01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      112655674 Membrane trafficking [BR:clud04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     112655674 Chromosome and associated proteins [BR:clud03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      112655674 Exosome [BR:clud04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    112655674 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg UPF0154 EF-hand_11 EFhand_Ca_insen Dockerin_1 Caleosin FCaBP_EF-hand DUF5580_M DUF1103 SPEF2_C TerB SurA_N_3 Motif Other DBs NCBI-GeneID:  112655674 NCBI-ProteinID:  XP_025296675 LinkDB All DBs Position 9:complement(34606197..34607338) Genome browser AA seq 166 aa AA seqDB search MLLGLCGRFSETGSACSMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQN PTEAKLQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISA AELRHVMTNLGEKLTDEEVDEMIREPDIDGDGQVNYEEFVQMMTAK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgcttttagggttgtgtggccgcttctcggagaccggtagcgcttgcagcatggctgac caactgactgaggagcagattgcagaattcaaagaagccttttcactatttgacaaggat ggtgatggaactataacaacaaaggaattgggaactgtaatgaggtctcttgggcagaat cccacagaagcaaagttacaggacatgattaatgaagtagatgctgatggaaatggcaca attgacttcccggaatttctgacaatgatggcaagaaaaatgaaagacacagacagtgaa gaagaaattagagaagcattccgtgtgtttgataaggatggcaatggctatattagtgca gcagagcttcgccatgtgatgacaaacctgggagagaagttaacagatgaagaggttgat gaaatgatcagggaaccagatattgatggtgatggtcaagtaaactatgaagagtttgta caaatgatgacagcaaagtga

DBGET integrated database retrieval system