Canis lupus dingo (dingo): 112657016 Help Entry 112657016         CDS       T08371                                  Name (RefSeq) histone H2B type 1-A   KO K11252   histone H2B Organism clud  Canis lupus dingo (dingo) Pathway clud04613   Neutrophil extracellular trap formation clud05034   Alcoholism clud05203   Viral carcinogenesis clud05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:clud00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112657016  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     112657016   09163 Immune disease    05322 Systemic lupus erythematosus     112657016   09165 Substance dependence    05034 Alcoholism     112657016  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:clud03036]     112657016   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clud04147]     112657016 Chromosome and associated proteins [BR:clud03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112657016 Exosome [BR:clud04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112657016 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CvfB_WH Motif Other DBs NCBI-GeneID:  112657016 NCBI-ProteinID:  XP_025298494 Ensembl:  ENSCAFG00020009439 UniProt:  A0A8C0QXY5 LinkDB All DBs Position 35:23802788..23813070 Genome browser AA seq 127 aa AA seqDB search MPELTSKGTTISKKGFKRAVAKTQKKEGKKRRRCRKESYSIYIYKVLKQVHPDTGISSKA MGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgccggagctgacttcgaagggcactaccatctccaagaaaggcttcaagagagctgta gccaaaacccagaagaaagagggaaaaaagcgcaggagatgccggaaagagagctattct atctacatctacaaggtgctgaagcaggtgcaccccgacacgggcatctcgtccaaggcc atgggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcg cgcctggcgcattacaacaagcgctcgaccatcacgtccagggagatccagacggccgtg cgcctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtc accaagtacaccagctccaagtaa

DBGET integrated database retrieval system