Canis lupus dingo (dingo): 112657134
Help
Entry
112657134 CDS
T08371
Symbol
XRCC3
Name
(RefSeq) DNA repair protein XRCC3
KO
K10880
DNA-repair protein XRCC3
Organism
clud
Canis lupus dingo (dingo)
Pathway
clud03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
clud00001
]
09120 Genetic Information Processing
09124 Replication and repair
03440 Homologous recombination
112657134 (XRCC3)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:
clud03400
]
112657134 (XRCC3)
DNA repair and recombination proteins [BR:
clud03400
]
Eukaryotic type
DSBR (double strand breaks repair)
HR (homologous recombination)
RecA family proteins
112657134 (XRCC3)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Rad51
AAA_25
RecA
ATPase
DnaB_C
RNA_pol_A_CTD
Motif
Other DBs
NCBI-GeneID:
112657134
NCBI-ProteinID:
XP_025298769
Ensembl:
ENSCAFG00020008703
UniProt:
A0A8C0K685
LinkDB
All DBs
Position
8:complement(71616287..71623321)
Genome browser
AA seq
349 aa
AA seq
DB search
MDLDQLDLNPRIIAAVKKAKLKSIKEVLHFSGPDLQRLTSLSSLDVQHLLRAASSRLRGG
GVLTALQLCERAGGLPARPQRLSLGCPVLDRLLRGGLPLDGVTELAGLSSAGKTQLALQL
CLAVQFPPRHGGLDAGAMYICTEDVFPNLRLQQLIAQQQRLRTDVPGEVVSRIKFSNQIF
IEHVADVDSLLECVREKVPVLLSRGMARLVVIDSVAAPFRCEFDGPALVPRARHLQALGA
ALRRLSCAFQSPVLCINQVTEATEEQGTAPRPHGLRDERVSPALGMTWSNQLLMRLMVHR
RRPGDEAVTPAGPPDRTLSVVFAPHLPPSSCSYTVNAEGVRGTPGTESC
NT seq
1050 nt
NT seq
+upstream
nt +downstream
nt
atggatttggatcaattggacctgaatcccaggattattgctgcagttaagaaagccaaa
ctgaaatcaataaaggaggttttgcatttttctggcccggacctgcagagactgaccagc
ctgtccagcctggacgtgcagcacttgctgagagcggcctcctcacgcctgcggggaggc
ggtgtcctcacagcgctgcagctgtgcgagcgggcgggggggctccccgcgcggccccag
cgcctgagcctcggctgccccgtgctggaccggctcctccgcggcggcctgcccctggac
ggcgtcaccgagctggccggcctcagctccgccgggaagacccagctggccctgcagctc
tgcctggcggtgcagttcccgccgcgccacgggggcctggacgcaggggccatgtacatc
tgcacggaagacgtcttcccaaacctgcgcctgcagcagctcatcgcgcagcagcagcgc
ctacggacagacgttccgggagaggtagtcagcaggataaaattcagcaaccagatcttc
atcgagcacgtggccgacgtggactccctgctggagtgtgtgagggagaaggtgcccgtg
ctgctgtcccgggggatggcccgtctggtggtcatcgactccgtggcggccccattccgc
tgtgagtttgacggcccggccttggtccccagggccaggcatctgcaggccctgggagcc
gccctgcgccggctgagctgtgccttccagagcccagtgctgtgcatcaaccaggtgaca
gaggccacagaggagcagggcacagcgccccggccacacgggctccgggacgagcgtgtt
tctccagcccttggaatgacctggtccaaccagctcctcatgaggttgatggtccaccgg
cgccgccccggggacgaggccgtcaccccagccggcccccctgaccgcaccctgagcgtg
gtcttcgcccctcacctgccgccctcctcctgttcctacacagtcaacgctgagggagtg
cgagggaccccggggaccgagtcctgttga
DBGET
integrated database retrieval system