Canis lupus dingo (dingo): 112657364 Help Entry 112657364         CDS       T08371                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism clud  Canis lupus dingo (dingo) Pathway clud04024   cAMP signaling pathway clud04062   Chemokine signaling pathway clud04064   NF-kappa B signaling pathway clud04210   Apoptosis clud04380   Osteoclast differentiation clud04620   Toll-like receptor signaling pathway clud04621   NOD-like receptor signaling pathway clud04622   RIG-I-like receptor signaling pathway clud04623   Cytosolic DNA-sensing pathway clud04625   C-type lectin receptor signaling pathway clud04657   IL-17 signaling pathway clud04658   Th1 and Th2 cell differentiation clud04659   Th17 cell differentiation clud04660   T cell receptor signaling pathway clud04662   B cell receptor signaling pathway clud04668   TNF signaling pathway clud04722   Neurotrophin signaling pathway clud04920   Adipocytokine signaling pathway clud04926   Relaxin signaling pathway clud04931   Insulin resistance clud04936   Alcoholic liver disease clud05132   Salmonella infection clud05134   Legionellosis clud05135   Yersinia infection clud05140   Leishmaniasis clud05142   Chagas disease clud05145   Toxoplasmosis clud05160   Hepatitis C clud05161   Hepatitis B clud05162   Measles clud05163   Human cytomegalovirus infection clud05164   Influenza A clud05166   Human T-cell leukemia virus 1 infection clud05167   Kaposi sarcoma-associated herpesvirus infection clud05168   Herpes simplex virus 1 infection clud05169   Epstein-Barr virus infection clud05170   Human immunodeficiency virus 1 infection clud05171   Coronavirus disease - COVID-19 clud05200   Pathways in cancer clud05203   Viral carcinogenesis clud05208   Chemical carcinogenesis - reactive oxygen species clud05215   Prostate cancer clud05220   Chronic myeloid leukemia clud05222   Small cell lung cancer clud05235   PD-L1 expression and PD-1 checkpoint pathway in cancer clud05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     112657364 (NFKBIA)    04668 TNF signaling pathway     112657364 (NFKBIA)    04024 cAMP signaling pathway     112657364 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     112657364 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112657364 (NFKBIA)    04621 NOD-like receptor signaling pathway     112657364 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     112657364 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     112657364 (NFKBIA)    04625 C-type lectin receptor signaling pathway     112657364 (NFKBIA)    04660 T cell receptor signaling pathway     112657364 (NFKBIA)    04658 Th1 and Th2 cell differentiation     112657364 (NFKBIA)    04659 Th17 cell differentiation     112657364 (NFKBIA)    04657 IL-17 signaling pathway     112657364 (NFKBIA)    04662 B cell receptor signaling pathway     112657364 (NFKBIA)    04062 Chemokine signaling pathway     112657364 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     112657364 (NFKBIA)    04926 Relaxin signaling pathway     112657364 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     112657364 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     112657364 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112657364 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     112657364 (NFKBIA)    05203 Viral carcinogenesis     112657364 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112657364 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     112657364 (NFKBIA)    05215 Prostate cancer     112657364 (NFKBIA)    05222 Small cell lung cancer     112657364 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112657364 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     112657364 (NFKBIA)    05161 Hepatitis B     112657364 (NFKBIA)    05160 Hepatitis C     112657364 (NFKBIA)    05171 Coronavirus disease - COVID-19     112657364 (NFKBIA)    05164 Influenza A     112657364 (NFKBIA)    05162 Measles     112657364 (NFKBIA)    05168 Herpes simplex virus 1 infection     112657364 (NFKBIA)    05163 Human cytomegalovirus infection     112657364 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     112657364 (NFKBIA)    05169 Epstein-Barr virus infection     112657364 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     112657364 (NFKBIA)    05135 Yersinia infection     112657364 (NFKBIA)    05134 Legionellosis     112657364 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     112657364 (NFKBIA)    05140 Leishmaniasis     112657364 (NFKBIA)    05142 Chagas disease     112657364 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112657364 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112657364 (NFKBIA)    04931 Insulin resistance     112657364 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:clud03000]     112657364 (NFKBIA)    04131 Membrane trafficking [BR:clud04131]     112657364 (NFKBIA) Transcription factors [BR:clud03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     112657364 (NFKBIA) Membrane trafficking [BR:clud04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     112657364 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  112657364 NCBI-ProteinID:  XP_025299111 Ensembl:  ENSCAFG00020023383 UniProt:  A0A8C0LBR1 LinkDB All DBs Position 8:complement(14130085..14133362) Genome browser AA seq 314 aa AA seqDB search MLQQAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQLVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLYSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgctgcagcaagccgagcacgcccaggactgggccatggagggtccccgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagctggtgaaggagctgcgggagatccgtctcgagccgcaggaggcgccg cgcggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggccctgaccatggaagtggtccgccaagtgaagggcgac ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccaaccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcaaggctgcctggccagcgtg ggagtcctgactcagacttgcaggacccagcacctctactccatcctccaggccaccaac tacaatggtcacacatgtctacatttagcttctatccatggctatttgggcattgtggag cttctggtgtctttgggtgctgatgtcaatgctcaggagccctgtaatggccgaaccgcc ctccatcttgcagtggacctgcagaattctgaccttgtgtcgcttttgttgaagtgtggg gctgatgtcaacagagttacctaccagggctactccccgtaccagctcacgtggggccgc ccaagcacacggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg ccagagagtgaggatgaggagagctatgacacagagtcagagttcacagaggacgagctg ccctatgatgactgtgtgcttggaggccagcgcttgacgttatga

DBGET integrated database retrieval system