Canis lupus dingo (dingo): 112658250 Help Entry 112658250         CDS       T08371                                  Symbol EDN1 Name (RefSeq) endothelin-1   KO K16366   endothelin-1 Organism clud  Canis lupus dingo (dingo) Pathway clud04024   cAMP signaling pathway clud04066   HIF-1 signaling pathway clud04080   Neuroactive ligand-receptor interaction clud04270   Vascular smooth muscle contraction clud04668   TNF signaling pathway clud04916   Melanogenesis clud04924   Renin secretion clud04926   Relaxin signaling pathway clud04933   AGE-RAGE signaling pathway in diabetic complications clud05200   Pathways in cancer clud05410   Hypertrophic cardiomyopathy clud05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     112658250 (EDN1)    04066 HIF-1 signaling pathway     112658250 (EDN1)    04024 cAMP signaling pathway     112658250 (EDN1)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     112658250 (EDN1)  09150 Organismal Systems   09152 Endocrine system    04926 Relaxin signaling pathway     112658250 (EDN1)    04916 Melanogenesis     112658250 (EDN1)    04924 Renin secretion     112658250 (EDN1)   09153 Circulatory system    04270 Vascular smooth muscle contraction     112658250 (EDN1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112658250 (EDN1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     112658250 (EDN1)    05410 Hypertrophic cardiomyopathy     112658250 (EDN1)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     112658250 (EDN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clud04052]     112658250 (EDN1) Cytokines and neuropeptides [BR:clud04052]  Neuropeptides   GPCR binding    112658250 (EDN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Endothelin Motif Other DBs NCBI-GeneID:  112658250 NCBI-ProteinID:  XP_025300121 Ensembl:  ENSCAFG00020013020 UniProt:  A0A8C0R017 LinkDB All DBs Position 35:11910329..11917315 Genome browser AA seq 202 aa AA seqDB search MDYFPMIFSLLFVAFQGAPEAAVLGAELSTGPDSRGEKPAPSAPWRPRRSKRCSCSSLMD KECVYFCHLDIIWVNTPEHIVPYGLGSPSRSKRSLKDLFITKATDHRKRCQCASQKDKKC WTFCQAGKELREQDSMEKGWNGHKKGKDCSELGEKSKQQQLVAGRKIRRLDAISNSIKTA FRVAKLKAELYRENKVTHNRTH NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggattatttccccatgattttttctctgctgtttgtggctttccaaggagctccagaa gcagcggtcctgggtgcggagctcagcacaggcccggacagcaggggggagaagcctgct cccagtgcaccctggcggccccgccgatccaagcgctgctcctgctcttccctgatggat aaagagtgtgtctacttctgccaccttgacatcatctgggtcaacactcctgagcacatt gttccgtatggacttggaagcccttctaggtctaagcgatctttaaaggatttatttatc acaaaggcaacagaccacaggaagagatgccagtgtgctagccaaaaagacaagaagtgc tggactttttgccaagcgggaaaagaactcagggagcaagacagtatggagaagggctgg aatggccataagaaaggaaaagactgttctgagcttggagaaaagtccaagcagcagcag ctggtggcaggaagaaaaataagaaggttggacgccatcagcaacagcatcaaaacagct ttccgtgttgcaaagctgaaagcagagctctacagagagaacaaagtgacccataatcga acacactga

DBGET integrated database retrieval system