Canis lupus dingo (dingo): 112659069 Help Entry 112659069         CDS       T08371                                  Symbol CALML5 Name (RefSeq) calmodulin-like protein 5   KO K02183   calmodulin Organism clud  Canis lupus dingo (dingo) Pathway clud04014   Ras signaling pathway clud04015   Rap1 signaling pathway clud04020   Calcium signaling pathway clud04022   cGMP-PKG signaling pathway clud04024   cAMP signaling pathway clud04070   Phosphatidylinositol signaling system clud04114   Oocyte meiosis clud04218   Cellular senescence clud04261   Adrenergic signaling in cardiomyocytes clud04270   Vascular smooth muscle contraction clud04371   Apelin signaling pathway clud04625   C-type lectin receptor signaling pathway clud04713   Circadian entrainment clud04720   Long-term potentiation clud04722   Neurotrophin signaling pathway clud04728   Dopaminergic synapse clud04740   Olfactory transduction clud04744   Phototransduction clud04750   Inflammatory mediator regulation of TRP channels clud04910   Insulin signaling pathway clud04912   GnRH signaling pathway clud04915   Estrogen signaling pathway clud04916   Melanogenesis clud04921   Oxytocin signaling pathway clud04922   Glucagon signaling pathway clud04924   Renin secretion clud04925   Aldosterone synthesis and secretion clud04970   Salivary secretion clud04971   Gastric acid secretion clud05010   Alzheimer disease clud05012   Parkinson disease clud05022   Pathways of neurodegeneration - multiple diseases clud05031   Amphetamine addiction clud05034   Alcoholism clud05133   Pertussis clud05152   Tuberculosis clud05163   Human cytomegalovirus infection clud05167   Kaposi sarcoma-associated herpesvirus infection clud05170   Human immunodeficiency virus 1 infection clud05200   Pathways in cancer clud05214   Glioma clud05417   Lipid and atherosclerosis clud05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     112659069 (CALML5)    04015 Rap1 signaling pathway     112659069 (CALML5)    04371 Apelin signaling pathway     112659069 (CALML5)    04020 Calcium signaling pathway     112659069 (CALML5)    04070 Phosphatidylinositol signaling system     112659069 (CALML5)    04024 cAMP signaling pathway     112659069 (CALML5)    04022 cGMP-PKG signaling pathway     112659069 (CALML5)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     112659069 (CALML5)    04218 Cellular senescence     112659069 (CALML5)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112659069 (CALML5)   09152 Endocrine system    04910 Insulin signaling pathway     112659069 (CALML5)    04922 Glucagon signaling pathway     112659069 (CALML5)    04912 GnRH signaling pathway     112659069 (CALML5)    04915 Estrogen signaling pathway     112659069 (CALML5)    04921 Oxytocin signaling pathway     112659069 (CALML5)    04916 Melanogenesis     112659069 (CALML5)    04924 Renin secretion     112659069 (CALML5)    04925 Aldosterone synthesis and secretion     112659069 (CALML5)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     112659069 (CALML5)    04270 Vascular smooth muscle contraction     112659069 (CALML5)   09154 Digestive system    04970 Salivary secretion     112659069 (CALML5)    04971 Gastric acid secretion     112659069 (CALML5)   09156 Nervous system    04728 Dopaminergic synapse     112659069 (CALML5)    04720 Long-term potentiation     112659069 (CALML5)    04722 Neurotrophin signaling pathway     112659069 (CALML5)   09157 Sensory system    04744 Phototransduction     112659069 (CALML5)    04740 Olfactory transduction     112659069 (CALML5)    04750 Inflammatory mediator regulation of TRP channels     112659069 (CALML5)   09159 Environmental adaptation    04713 Circadian entrainment     112659069 (CALML5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112659069 (CALML5)   09162 Cancer: specific types    05214 Glioma     112659069 (CALML5)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112659069 (CALML5)    05163 Human cytomegalovirus infection     112659069 (CALML5)    05167 Kaposi sarcoma-associated herpesvirus infection     112659069 (CALML5)   09171 Infectious disease: bacterial    05133 Pertussis     112659069 (CALML5)    05152 Tuberculosis     112659069 (CALML5)   09164 Neurodegenerative disease    05010 Alzheimer disease     112659069 (CALML5)    05012 Parkinson disease     112659069 (CALML5)    05022 Pathways of neurodegeneration - multiple diseases     112659069 (CALML5)   09165 Substance dependence    05031 Amphetamine addiction     112659069 (CALML5)    05034 Alcoholism     112659069 (CALML5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112659069 (CALML5)    05418 Fluid shear stress and atherosclerosis     112659069 (CALML5)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:clud01009]     112659069 (CALML5)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clud04131]     112659069 (CALML5)    03036 Chromosome and associated proteins [BR:clud03036]     112659069 (CALML5)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clud04147]     112659069 (CALML5) Protein phosphatases and associated proteins [BR:clud01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      112659069 (CALML5) Membrane trafficking [BR:clud04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     112659069 (CALML5) Chromosome and associated proteins [BR:clud03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      112659069 (CALML5) Exosome [BR:clud04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    112659069 (CALML5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 SPARC_Ca_bdg EF-hand_9 EH Dockerin_1 EF_EFCAB10_C EF-hand_11 FCaBP_EF-hand DUF5580_M TerB MCM4_WHD T2SSK SurA_N_2 RNase_H GlutR_dimer DUF3105 Motif Other DBs NCBI-GeneID:  112659069 NCBI-ProteinID:  XP_025301309 LinkDB All DBs Position 2:28964971..28965827 Genome browser AA seq 149 aa AA seqDB search MAEELPPEQVAKFKEVFSRFDKNGDNTINTQELGAVMQALGQDISEDELKMLIAQVDTDG DGVISFQEFLEAMVKRMKSWGSEQEMREVFRAFDLNGDGHISVDELKQAMAKLGELLSQE ELDTMIQEADVDKDGQVNYEEFMRILSQK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaggagctgcctccagaacaggtggccaagttcaaggaggtcttctccagattt gacaagaacggtgacaacaccatcaacacccaggagctgggcgctgtgatgcaggccctg ggccaggatatatcagaggacgagctgaagatgctcatcgcccaggtggacacggacggc gacggggtcatcagcttccaagagttcctggaggcgatggtcaagaggatgaagtcctgg ggcagtgagcaggagatgcgggaggtcttccgcgcctttgacctgaacggcgacggccac atcagcgtggacgagctcaagcaggccatggccaagctgggcgagttgctgtcccaggag gagctggacaccatgatccaggaggccgatgtggacaaggacgggcaagtgaactacgaa gagttcatgcgcatcctctcccagaagtga

DBGET integrated database retrieval system