Canis lupus dingo (dingo): 112659515 Help Entry 112659515         CDS       T08371                                  Symbol CFL1 Name (RefSeq) cofilin-1   KO K05765   cofilin Organism clud  Canis lupus dingo (dingo) Pathway clud04360   Axon guidance clud04666   Fc gamma R-mediated phagocytosis clud04810   Regulation of actin cytoskeleton clud05133   Pertussis clud05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:clud00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112659515 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     112659515 (CFL1)   09158 Development and regeneration    04360 Axon guidance     112659515 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112659515 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     112659515 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clud04131]     112659515 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:clud04812]     112659515 (CFL1)    04147 Exosome [BR:clud04147]     112659515 (CFL1) Membrane trafficking [BR:clud04131]  Others   Actin-binding proteins    Others     112659515 (CFL1) Cytoskeleton proteins [BR:clud04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      112659515 (CFL1) Exosome [BR:clud04147]  Exosomal proteins   Proteins found in most exosomes    112659515 (CFL1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  112659515 NCBI-ProteinID:  XP_025302209 Ensembl:  ENSCAFG00020015102 LinkDB All DBs Position 18:51342839..51346428 Genome browser AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggcgtggcggtttctgatggcgtcatcaaagtgttcaatgacatgaaggtg cgtaagtcttcaacacccgaggaagtgaagaagcgcaagaaggcagttcttttctgcctg agcgaggacaagaagaacatcatcctcgaggagggcaaggagatcctggtaggtgatgtg ggccagactgtagatgacccctacgccacctttgtcaagatgctaccagacaaggactgc cgctatgccctctatgacgcaacctatgagaccaaggagagcaagaaggaggacctggtg tttatcttctgggcacctgagtctgcaccccttaagagcaaaatgatttatgccagctcc aaggatgccatcaagaaaaagctgactgggatcaagcatgagttacaagcaaactgctac gaggaggtcaaggaccgctgcaccctggcagagaaactggggggcagtgccgtcatctct ctggagggcaagcctttgtga

DBGET integrated database retrieval system