Canis lupus dingo (dingo): 112660169 Help Entry 112660169         CDS       T08371                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism clud  Canis lupus dingo (dingo) Pathway clud04060   Cytokine-cytokine receptor interaction clud04061   Viral protein interaction with cytokine and cytokine receptor clud04062   Chemokine signaling pathway clud04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112660169 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     112660169 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112660169 (CCL22)    04062 Chemokine signaling pathway     112660169 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clud04052]     112660169 (CCL22) Cytokines and neuropeptides [BR:clud04052]  Cytokines   Chemokines    112660169 (CCL22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  112660169 NCBI-ProteinID:  XP_025303361 Ensembl:  ENSCAFG00020007531 UniProt:  A0A8C0K133 LinkDB All DBs Position 2:complement(57555655..57561440) Genome browser AA seq 93 aa AA seqDB search MASLKTPLLAALVFLVLTLQATEAGPYGANVEDSICCRDYIRHPLPLRLLKYFYWTSDSC RRPGVVFLTVKDREICADPRVPWVKKLLQKLDP NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgaagactccgctcctggctgcccttgtcttccttgttctgacacttcaa gcgactgaggcaggtccttacggtgccaacgtggaagacagtatctgctgccgggactac atccgtcaccctctgcccctgcgtctgctgaagtatttctactggacttcagactcctgc cggaggcctggcgtggtcttcctaactgtcaaggatcgggagatctgtgctgaccccaga gtgccctgggtgaagaagcttctccagaagctggacccatga

DBGET integrated database retrieval system