Canis lupus dingo (dingo): 112660370 Help Entry 112660370         CDS       T08371                                  Name (RefSeq) cofilin-1-like   KO K05765   cofilin Organism clud  Canis lupus dingo (dingo) Pathway clud04360   Axon guidance clud04666   Fc gamma R-mediated phagosome formation clud04810   Regulation of actin cytoskeleton clud05133   Pertussis clud05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:clud00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112660370  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagosome formation     112660370   09158 Development and regeneration    04360 Axon guidance     112660370  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112660370   09171 Infectious disease: bacterial    05133 Pertussis     112660370  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clud04131]     112660370   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:clud04812]     112660370    04147 Exosome [BR:clud04147]     112660370 Membrane trafficking [BR:clud04131]  Others   Actin-binding proteins    Others     112660370 Cytoskeleton proteins [BR:clud04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      112660370 Exosome [BR:clud04147]  Exosomal proteins   Proteins found in most exosomes    112660370 SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF DUF4931_N Motif Other DBs NCBI-GeneID:  112660370 NCBI-ProteinID:  XP_035569575 LinkDB All DBs Position 2:complement(62861869..62862276) Genome browser AA seq 135 aa AA seqDB search MASGVVVSDGVIKMFNDMKVPKSSTPEEVKKRKKAVLFCLSEDKKDIILEEGKEILVGDV GRTVDDLYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESALLKSKMIYARS KDAIKKKRTWIMHEF NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggcctctggcgtggtggtttctgacggtgtcatcaaaatgttcaatgacatgaaggtg cctaagtcctcaacaccagaggaggtgaagaagcgtaagaaggcagtacttttctgcctg agcgaagacaagaaggacatcatcctcgaggagggcaaggagatcctggtaggtgatgtg ggccggactgtagacgacctctacgccacctttgtcaagatgctaccagacaaggactgc cgctatgccctctatgatgcaacctatgagaccaaggagagcaagaaggaggacctggtg tttatcttctgggcacctgagtctgcactccttaagagcaaaatgatttatgccagatcc aaggatgccatcaagaaaaagaggacctggatcatgcatgaattttaa

DBGET integrated database retrieval system