Canis lupus dingo (dingo): 112660644 Help Entry 112660644         CDS       T08371                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism clud  Canis lupus dingo (dingo) Pathway clud04137   Mitophagy - animal clud04140   Autophagy - animal clud04144   Endocytosis clud04145   Phagosome clud04148   Efferocytosis clud05132   Salmonella infection clud05146   Amoebiasis clud05152   Tuberculosis Brite KEGG Orthology (KO) [BR:clud00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112660644 (RAB7A)    04145 Phagosome     112660644 (RAB7A)    04140 Autophagy - animal     112660644 (RAB7A)    04137 Mitophagy - animal     112660644 (RAB7A)    04148 Efferocytosis     112660644 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112660644 (RAB7A)    05152 Tuberculosis     112660644 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     112660644 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clud04131]     112660644 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clud04147]     112660644 (RAB7A)    04031 GTP-binding proteins [BR:clud04031]     112660644 (RAB7A) Membrane trafficking [BR:clud04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     112660644 (RAB7A) Exosome [BR:clud04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112660644 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    112660644 (RAB7A)   Exosomal proteins of colorectal cancer cells    112660644 (RAB7A)   Exosomal proteins of bladder cancer cells    112660644 (RAB7A) GTP-binding proteins [BR:clud04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     112660644 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  112660644 NCBI-ProteinID:  XP_035558360 Ensembl:  ENSCAFG00020004847 UniProt:  A0A8C0QVB9 LinkDB All DBs Position 20:2900592..2972539 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKTSAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagttggt aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagctaca ataggagcagactttctgacaaaggaggtgatggtggatgacagactagttacaatgcag atctgggacacagcaggccaggaacggttccagtcccttggtgtggccttctacagaggt gcagactgctgcgttctggtatttgacgttactgcccccaacacattcaaaaccctcgat agctggagagatgagtttctcatccaggccagtccccgggatcctgaaaacttccctttc gttgtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc aatgtggagcaggcgttccagacgattgcaaggaatgcacttaaacaggaaacagaggtg gagctgtacaatgaattccctgaacccatcaaactggacaagaacgaccgggccaagacc tcagcggaaagctgcagttgctga

DBGET integrated database retrieval system