Canis lupus dingo (dingo): 112663225 Help Entry 112663225         CDS       T08371                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism clud  Canis lupus dingo (dingo) Pathway clud04010   MAPK signaling pathway clud04014   Ras signaling pathway clud04015   Rap1 signaling pathway clud04022   cGMP-PKG signaling pathway clud04066   HIF-1 signaling pathway clud04068   FoxO signaling pathway clud04072   Phospholipase D signaling pathway clud04081   Hormone signaling clud04114   Oocyte meiosis clud04140   Autophagy - animal clud04150   mTOR signaling pathway clud04151   PI3K-Akt signaling pathway clud04152   AMPK signaling pathway clud04211   Longevity regulating pathway clud04213   Longevity regulating pathway - multiple species clud04810   Regulation of actin cytoskeleton clud04910   Insulin signaling pathway clud04911   Insulin secretion clud04913   Ovarian steroidogenesis clud04914   Progesterone-mediated oocyte maturation clud04917   Prolactin signaling pathway clud04923   Regulation of lipolysis in adipocytes clud04930   Type II diabetes mellitus clud04931   Insulin resistance clud04932   Non-alcoholic fatty liver disease clud04940   Type I diabetes mellitus clud04950   Maturity onset diabetes of the young clud04960   Aldosterone-regulated sodium reabsorption clud05010   Alzheimer disease clud05215   Prostate cancer clud05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112663225 (INS)    04014 Ras signaling pathway     112663225 (INS)    04015 Rap1 signaling pathway     112663225 (INS)    04066 HIF-1 signaling pathway     112663225 (INS)    04068 FoxO signaling pathway     112663225 (INS)    04072 Phospholipase D signaling pathway     112663225 (INS)    04022 cGMP-PKG signaling pathway     112663225 (INS)    04151 PI3K-Akt signaling pathway     112663225 (INS)    04152 AMPK signaling pathway     112663225 (INS)    04150 mTOR signaling pathway     112663225 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     112663225 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112663225 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     112663225 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112663225 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     112663225 (INS)    04910 Insulin signaling pathway     112663225 (INS)    04923 Regulation of lipolysis in adipocytes     112663225 (INS)    04913 Ovarian steroidogenesis     112663225 (INS)    04914 Progesterone-mediated oocyte maturation     112663225 (INS)    04917 Prolactin signaling pathway     112663225 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     112663225 (INS)   09149 Aging    04211 Longevity regulating pathway     112663225 (INS)    04213 Longevity regulating pathway - multiple species     112663225 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     112663225 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     112663225 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     112663225 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     112663225 (INS)    04940 Type I diabetes mellitus     112663225 (INS)    04950 Maturity onset diabetes of the young     112663225 (INS)    04932 Non-alcoholic fatty liver disease     112663225 (INS)    04931 Insulin resistance     112663225 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clud04052]     112663225 (INS) Cytokines and neuropeptides [BR:clud04052]  Neuropeptides   Unclassified    112663225 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  112663225 NCBI-ProteinID:  XP_025307639 Ensembl:  ENSCAFG00020017402 UniProt:  A0A8C0R307 LinkDB All DBs Position 18:complement(46241457..46242418) Genome browser AA seq 110 aa AA seqDB search MALWMRLLPLLALLALWAPAPTRAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVED LQVRDVELAGAPGEGGLQPLALEGALQKRGIVEQCCTSICSLYQLENYCN NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggccctctggatgcgcctcctgcccctgctggccctgctggccctctgggcgcccgcg cccacccgagccttcgttaaccagcacctgtgtggctcccacctggtagaggctctgtac ctggtgtgcggggagcgcggcttcttctacacgcctaaggcccgccgggaggtggaggac ctgcaggtgagggacgtggagctggccggggcgcctggcgagggcggcctgcagcccctg gccctggagggggccctgcagaagcgaggcatcgtggagcagtgctgcaccagcatctgc tccctctaccagctggagaattactgcaactag

DBGET integrated database retrieval system