Canis lupus dingo (dingo): 112663445 Help Entry 112663445         CDS       T08371                                  Symbol CD59 Name (RefSeq) CD59 glycoprotein   KO K04008   CD59 antigen Organism clud  Canis lupus dingo (dingo) Pathway clud04610   Complement and coagulation cascades clud04640   Hematopoietic cell lineage Brite KEGG Orthology (KO) [BR:clud00001]  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     112663445 (CD59)    04610 Complement and coagulation cascades     112663445 (CD59)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clud04147]     112663445 (CD59)    04090 CD molecules [BR:clud04090]     112663445 (CD59)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:clud00537]     112663445 (CD59) Exosome [BR:clud04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112663445 (CD59)   Exosomal proteins of other body fluids (saliva and urine)    112663445 (CD59)   Exosomal proteins of colorectal cancer cells    112663445 (CD59) CD molecules [BR:clud04090]  Proteins   112663445 (CD59) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:clud00537]  Antigens   112663445 (CD59) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Holin_2-3 DUF5346 Motif Other DBs NCBI-GeneID:  112663445 NCBI-ProteinID:  XP_048952676 Ensembl:  ENSCAFG00020004510 LinkDB All DBs Position 18:33904883..33926659 Genome browser AA seq 123 aa AA seqDB search MGSKGGFILPVLLLILAALCHSGHSLTCYSCPESEYICNNTISCGINLDACLFIKADPLR YHYQCWRQKDCNYQYISNSFQIKKLEYYCCQKDLCNGSAGMSASRKTALLVTPLLAVAWT LYL NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgggaagcaaaggaggattcatcctgccggtgcttctgctcatcctggctgccctctgc cattcaggtcatagcctgacatgctacagctgtcctgaatcagagtatatctgcaataat accatcagttgtgggattaatcttgatgcgtgtcttttcatcaaagccgatcccctaaga tatcactaccagtgttggaggcagaaagattgcaattaccagtacatttcaaactctttc caaattaagaagctagagtactattgctgccagaaggacctgtgtaatggaagtgcgggc atgagtgcctccaggaagacggctctgctggtgaccccattgctggcggtagcctggacc ctgtatctctaa

DBGET integrated database retrieval system