Canis lupus dingo (dingo): 112663939 Help Entry 112663939         CDS       T08371                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism clud  Canis lupus dingo (dingo) Pathway clud04382   Cornified envelope formation clud05132   Salmonella infection Brite KEGG Orthology (KO) [BR:clud00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     112663939 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112663939 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clud04147]     112663939 (S100A10) Exosome [BR:clud04147]  Exosomal proteins   Exosomal proteins of microglial cells    112663939 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  112663939 NCBI-ProteinID:  XP_025308745 Ensembl:  ENSCAFG00020009496 UniProt:  A0A8C0K9Q1 LinkDB All DBs Position 17:complement(60905599..60916298) Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVIHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggaacatgccatggaaaccatgatgttcacgtttcacaagtttgct ggggataaaggatacttgacaaaggaagacctgagagtactcatggaaaaggaattccca ggatttttggaaaatcaaaaagaccctctggccgtggacaaaataatgaaggacctcgac cagtgccgagatggcaaagtgggcttccagagcttcttttcactaattgctgggctcacc attgcatgcaatgactattttgtaatacacatgaagcagaagggcaagaaatag

DBGET integrated database retrieval system