Canis lupus dingo (dingo): 112664037 Help Entry 112664037         CDS       T08371                                  Name (RefSeq) histone H2B type 2-E   KO K11252   histone H2B Organism clud  Canis lupus dingo (dingo) Pathway clud04613   Neutrophil extracellular trap formation clud05034   Alcoholism clud05203   Viral carcinogenesis clud05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:clud00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112664037  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     112664037   09163 Immune disease    05322 Systemic lupus erythematosus     112664037   09165 Substance dependence    05034 Alcoholism     112664037  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:clud03036]     112664037   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clud04147]     112664037 Chromosome and associated proteins [BR:clud03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112664037 Exosome [BR:clud04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112664037 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  112664037 NCBI-ProteinID:  XP_025308984 Ensembl:  ENSCAFG00020019854 LinkDB All DBs Position 17:59068151..59069136 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcccgagccggcgaaatccgctcccgcgcccaagaagggctccaagaaagcggtcacc aaggcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccatc tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccggcgaggcctcccgc ctggcgcattacaacaagcgctccaccatcacctcccgggagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system