Canis lupus dingo (dingo): 112664166 Help Entry 112664166         CDS       T08371                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism clud  Canis lupus dingo (dingo) Pathway clud01521   EGFR tyrosine kinase inhibitor resistance clud01522   Endocrine resistance clud04010   MAPK signaling pathway clud04012   ErbB signaling pathway clud04014   Ras signaling pathway clud04015   Rap1 signaling pathway clud04062   Chemokine signaling pathway clud04068   FoxO signaling pathway clud04071   Sphingolipid signaling pathway clud04072   Phospholipase D signaling pathway clud04137   Mitophagy - animal clud04140   Autophagy - animal clud04150   mTOR signaling pathway clud04151   PI3K-Akt signaling pathway clud04210   Apoptosis clud04211   Longevity regulating pathway clud04213   Longevity regulating pathway - multiple species clud04218   Cellular senescence clud04360   Axon guidance clud04370   VEGF signaling pathway clud04371   Apelin signaling pathway clud04540   Gap junction clud04550   Signaling pathways regulating pluripotency of stem cells clud04625   C-type lectin receptor signaling pathway clud04650   Natural killer cell mediated cytotoxicity clud04660   T cell receptor signaling pathway clud04662   B cell receptor signaling pathway clud04664   Fc epsilon RI signaling pathway clud04714   Thermogenesis clud04720   Long-term potentiation clud04722   Neurotrophin signaling pathway clud04725   Cholinergic synapse clud04726   Serotonergic synapse clud04730   Long-term depression clud04810   Regulation of actin cytoskeleton clud04910   Insulin signaling pathway clud04912   GnRH signaling pathway clud04915   Estrogen signaling pathway clud04916   Melanogenesis clud04917   Prolactin signaling pathway clud04919   Thyroid hormone signaling pathway clud04921   Oxytocin signaling pathway clud04926   Relaxin signaling pathway clud04929   GnRH secretion clud04933   AGE-RAGE signaling pathway in diabetic complications clud04935   Growth hormone synthesis, secretion and action clud05010   Alzheimer disease clud05022   Pathways of neurodegeneration - multiple diseases clud05034   Alcoholism clud05160   Hepatitis C clud05161   Hepatitis B clud05163   Human cytomegalovirus infection clud05165   Human papillomavirus infection clud05166   Human T-cell leukemia virus 1 infection clud05167   Kaposi sarcoma-associated herpesvirus infection clud05170   Human immunodeficiency virus 1 infection clud05200   Pathways in cancer clud05203   Viral carcinogenesis clud05205   Proteoglycans in cancer clud05206   MicroRNAs in cancer clud05207   Chemical carcinogenesis - receptor activation clud05208   Chemical carcinogenesis - reactive oxygen species clud05210   Colorectal cancer clud05211   Renal cell carcinoma clud05213   Endometrial cancer clud05214   Glioma clud05215   Prostate cancer clud05216   Thyroid cancer clud05218   Melanoma clud05219   Bladder cancer clud05220   Chronic myeloid leukemia clud05221   Acute myeloid leukemia clud05223   Non-small cell lung cancer clud05224   Breast cancer clud05225   Hepatocellular carcinoma clud05226   Gastric cancer clud05230   Central carbon metabolism in cancer clud05231   Choline metabolism in cancer clud05235   PD-L1 expression and PD-1 checkpoint pathway in cancer clud05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112664166 (NRAS)    04012 ErbB signaling pathway     112664166 (NRAS)    04014 Ras signaling pathway     112664166 (NRAS)    04015 Rap1 signaling pathway     112664166 (NRAS)    04370 VEGF signaling pathway     112664166 (NRAS)    04371 Apelin signaling pathway     112664166 (NRAS)    04068 FoxO signaling pathway     112664166 (NRAS)    04072 Phospholipase D signaling pathway     112664166 (NRAS)    04071 Sphingolipid signaling pathway     112664166 (NRAS)    04151 PI3K-Akt signaling pathway     112664166 (NRAS)    04150 mTOR signaling pathway     112664166 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112664166 (NRAS)    04137 Mitophagy - animal     112664166 (NRAS)   09143 Cell growth and death    04210 Apoptosis     112664166 (NRAS)    04218 Cellular senescence     112664166 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     112664166 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     112664166 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112664166 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112664166 (NRAS)    04650 Natural killer cell mediated cytotoxicity     112664166 (NRAS)    04660 T cell receptor signaling pathway     112664166 (NRAS)    04662 B cell receptor signaling pathway     112664166 (NRAS)    04664 Fc epsilon RI signaling pathway     112664166 (NRAS)    04062 Chemokine signaling pathway     112664166 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     112664166 (NRAS)    04929 GnRH secretion     112664166 (NRAS)    04912 GnRH signaling pathway     112664166 (NRAS)    04915 Estrogen signaling pathway     112664166 (NRAS)    04917 Prolactin signaling pathway     112664166 (NRAS)    04921 Oxytocin signaling pathway     112664166 (NRAS)    04926 Relaxin signaling pathway     112664166 (NRAS)    04935 Growth hormone synthesis, secretion and action     112664166 (NRAS)    04919 Thyroid hormone signaling pathway     112664166 (NRAS)    04916 Melanogenesis     112664166 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     112664166 (NRAS)    04726 Serotonergic synapse     112664166 (NRAS)    04720 Long-term potentiation     112664166 (NRAS)    04730 Long-term depression     112664166 (NRAS)    04722 Neurotrophin signaling pathway     112664166 (NRAS)   09158 Development and regeneration    04360 Axon guidance     112664166 (NRAS)   09149 Aging    04211 Longevity regulating pathway     112664166 (NRAS)    04213 Longevity regulating pathway - multiple species     112664166 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     112664166 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112664166 (NRAS)    05206 MicroRNAs in cancer     112664166 (NRAS)    05205 Proteoglycans in cancer     112664166 (NRAS)    05207 Chemical carcinogenesis - receptor activation     112664166 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     112664166 (NRAS)    05203 Viral carcinogenesis     112664166 (NRAS)    05230 Central carbon metabolism in cancer     112664166 (NRAS)    05231 Choline metabolism in cancer     112664166 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112664166 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     112664166 (NRAS)    05225 Hepatocellular carcinoma     112664166 (NRAS)    05226 Gastric cancer     112664166 (NRAS)    05214 Glioma     112664166 (NRAS)    05216 Thyroid cancer     112664166 (NRAS)    05221 Acute myeloid leukemia     112664166 (NRAS)    05220 Chronic myeloid leukemia     112664166 (NRAS)    05218 Melanoma     112664166 (NRAS)    05211 Renal cell carcinoma     112664166 (NRAS)    05219 Bladder cancer     112664166 (NRAS)    05215 Prostate cancer     112664166 (NRAS)    05213 Endometrial cancer     112664166 (NRAS)    05224 Breast cancer     112664166 (NRAS)    05223 Non-small cell lung cancer     112664166 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112664166 (NRAS)    05170 Human immunodeficiency virus 1 infection     112664166 (NRAS)    05161 Hepatitis B     112664166 (NRAS)    05160 Hepatitis C     112664166 (NRAS)    05163 Human cytomegalovirus infection     112664166 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     112664166 (NRAS)    05165 Human papillomavirus infection     112664166 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     112664166 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     112664166 (NRAS)   09165 Substance dependence    05034 Alcoholism     112664166 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112664166 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     112664166 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     112664166 (NRAS)    01522 Endocrine resistance     112664166 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clud04131]     112664166 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clud04147]     112664166 (NRAS)    04031 GTP-binding proteins [BR:clud04031]     112664166 (NRAS) Membrane trafficking [BR:clud04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     112664166 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     112664166 (NRAS) Exosome [BR:clud04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112664166 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    112664166 (NRAS)   Exosomal proteins of breast cancer cells    112664166 (NRAS)   Exosomal proteins of colorectal cancer cells    112664166 (NRAS) GTP-binding proteins [BR:clud04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     112664166 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  112664166 NCBI-ProteinID:  XP_025309236 LinkDB All DBs Position 17:complement(52511200..52521278) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagacggtgaaacctgtctgttggatatactggatacagctggt caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaaatcatttgcagacattaacctctacagggaacagatt aagcgagtaaaagattcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgtcgaggatgccttttacacactggta agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgatgggactcaaggt tgtatggggttaccatgtgtggtgatgtaa

DBGET integrated database retrieval system