Canis lupus dingo (dingo): 112664413 Help Entry 112664413         CDS       T08371                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism clud  Canis lupus dingo (dingo) Pathway clud04382   Cornified envelope formation clud05132   Salmonella infection Brite KEGG Orthology (KO) [BR:clud00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     112664413  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112664413  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clud04147]     112664413 Exosome [BR:clud04147]  Exosomal proteins   Exosomal proteins of microglial cells    112664413 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  112664413 NCBI-ProteinID:  XP_048951375 LinkDB All DBs Position 17:36304196..36307662 Genome browser AA seq 96 aa AA seqDB search MQSQMGHTMETVIFMSYKFAGDKSYLTKVDLRVLMERVPRFSEKQEDPLAVDKITKDQEQ SRDGKVDFQSFFLLIAGLTIACNDYFVVYMKQKGKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgcagtctcaaatgggacataccatggaaaccgtgatcttcatgtcttacaagtttgct ggggataaaagctacttaacaaaggtggacctgagagtactcatggaaagagttcccaga ttttcagaaaaacaagaagaccctctggctgtggacaaaataacaaaggaccaggaacag agccgagatggcaaagtggacttccagagcttctttttactaattgctgggcttaccatt gcatgcaatgactattttgtagtatacatgaagcagaagggaaaaaagtag

DBGET integrated database retrieval system