Canis lupus dingo (dingo): 112664563 Help Entry 112664563         CDS       T08371                                  Symbol DPY30 Name (RefSeq) protein dpy-30 homolog   KO K14965   protein dpy-30 Organism clud  Canis lupus dingo (dingo) Brite KEGG Orthology (KO) [BR:clud00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:clud03036]     112664563 (DPY30) Chromosome and associated proteins [BR:clud03036]  Eukaryotic type   Histone modification proteins    HMT complexes     COMPASS/SET1 complex      112664563 (DPY30)     MLL-HCF complex      112664563 (DPY30)     MLL3/MLL4 complex      112664563 (DPY30) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dpy-30 RIIa DUF7205 Motif Other DBs NCBI-GeneID:  112664563 NCBI-ProteinID:  XP_025310027 Ensembl:  ENSCAFG00020023631 UniProt:  A0A8C0LGZ5 LinkDB All DBs Position 17:complement(25396649..25417077) Genome browser AA seq 99 aa AA seqDB search MEPEQMLEGQTQVAENPHSEYGLTDNVERIVDNEKINAEKSSKQKVDLQSLPTRAYLDQT VVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFEDRN NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggagccagagcagatgctggaggggcagacgcaggttgcagaaaaccctcactctgag tacggtctcacagacaatgtggagaggatagtagacaatgagaagattaatgcagaaaag tcatcaaaacagaaagtggatctccagtctttgccaactcgtgcctacctggatcagaca gttgtgcctattttattacagggccttgctgtgcttgcaaaagaaagaccaccaaatccc attgaatttctagcatcatatcttttaaaaaacaaggcacagtttgaagatcgaaactga

DBGET integrated database retrieval system