Canis lupus dingo (dingo): 112664711 Help Entry 112664711         CDS       T08371                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism clud  Canis lupus dingo (dingo) Pathway clud04015   Rap1 signaling pathway clud04810   Regulation of actin cytoskeleton clud05014   Amyotrophic lateral sclerosis clud05132   Salmonella infection Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     112664711 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112664711 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112664711 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     112664711 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:clud04131]     112664711 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:clud04812]     112664711 (PFN4)    04147 Exosome [BR:clud04147]     112664711 (PFN4) Membrane trafficking [BR:clud04131]  Others   Actin-binding proteins    Others     112664711 (PFN4) Cytoskeleton proteins [BR:clud04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      112664711 (PFN4) Exosome [BR:clud04147]  Exosomal proteins   Proteins found in most exosomes    112664711 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  112664711 NCBI-ProteinID:  XP_025310307 Ensembl:  ENSCAFG00020025574 LinkDB All DBs Position 17:complement(18621339..18627321) Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFSVMPGDVRTLVNGFAKNPLQTR REGLYFKEKDYKCIRADDYSLYAKNEKTGVVVVKTHLYLLVATYTEGMYPSVCVEATEKL GEYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagtcatttgcagaacttgctgttagataccctcctgggaacaaagcatgtggacagt gcagcactcatcaaactccaggagcgaagcttgtgcgtggcatcgccaggatttagtgta atgcctggtgatgtccgaacacttgtgaatggattcgccaagaaccctttacaaaccaga agagaaggattgtatttcaaggaaaaggattacaaatgtatccgggcagatgactattct ctttatgctaagaatgaaaaaactggtgtggtggttgtgaagacccatctatatcttctg gtggcaacttacaccgaaggcatgtatcctagtgtttgtgtggaagccacagagaagctg ggagaatatctaagaagaaaaggaaattaa

DBGET integrated database retrieval system