Canis lupus dingo (dingo): 112665317 Help Entry 112665317         CDS       T08371                                  Name (RefSeq) histone H2B type 3-B   KO K11252   histone H2B Organism clud  Canis lupus dingo (dingo) Pathway clud04613   Neutrophil extracellular trap formation clud05034   Alcoholism clud05203   Viral carcinogenesis clud05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:clud00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112665317  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     112665317   09163 Immune disease    05322 Systemic lupus erythematosus     112665317   09165 Substance dependence    05034 Alcoholism     112665317  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:clud03036]     112665317   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:clud04147]     112665317 Chromosome and associated proteins [BR:clud03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112665317 Exosome [BR:clud04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112665317 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 LonB_AAA-LID CENP-T_C Motif Other DBs NCBI-GeneID:  112665317 NCBI-ProteinID:  XP_025310749 Ensembl:  ENSCAFG00020005888 LinkDB All DBs Position 14:complement(255304..256148) Genome browser AA seq 142 aa AA seqDB search MPAAELCSFCLERFATMPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYK VLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLP GELAKHAVSEGTKAVTKYTSSK NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgccggctgcagagctctgctctttttgtttggagaggtttgcgaccatgcctgatccg tctaagtcggcccccgcgcccaagaagggctccaaaaaggccgtcaccaaggcgcagaag aaggacggcaagaagcgcaagcgcagccgcaaggagagctactccatctacgtgtacaag gtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatgggcatcatgaac tcgttcgtcaacgacatctttgagcgcatcgccagcgaggcctcccgcctggcgcattac aacaagcgctcgaccatcacgtcccgcgaggtgcagacggccgtgcgcctgctgctgccc ggcgagctggccaagcacgcggtgtccgagggcaccaaggccgtcaccaagtacaccagc tccaagtga

DBGET integrated database retrieval system