Canis lupus dingo (dingo): 112666476 Help Entry 112666476         CDS       T08371                                  Symbol UBL5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism clud  Canis lupus dingo (dingo) Brite KEGG Orthology (KO) [BR:clud00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:clud03041]     112666476 (UBL5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clud04052]     112666476 (UBL5) Spliceosome [BR:clud03041]  Complex B   Other components    Complex B specific factors     112666476 (UBL5) Cytokines and neuropeptides [BR:clud04052]  Neuropeptides   Unclassified    112666476 (UBL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  112666476 NCBI-ProteinID:  XP_025313235 LinkDB All DBs Position 20:complement(51466971..51468852) Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccgtctagggaagaaggtccgcgttaagtgcaacact gatgacaccatcggggaccttaagaagctgatcgcagcccaaactggcacccgttggaac aagatcgtcctgaagaagtggtacacgattttcaaggaccacgtgtctttgggggactat gaaatccacgatgggatgaacctggagctttattaccaatag

DBGET integrated database retrieval system