Canis lupus dingo (dingo): 112668707 Help Entry 112668707         CDS       T08371                                  Symbol CCK Name (RefSeq) cholecystokinin   KO K05226   cholecystokinin Organism clud  Canis lupus dingo (dingo) Pathway clud04080   Neuroactive ligand-receptor interaction clud04081   Hormone signaling clud04911   Insulin secretion clud04972   Pancreatic secretion Brite KEGG Orthology (KO) [BR:clud00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     112668707 (CCK)    04081 Hormone signaling     112668707 (CCK)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     112668707 (CCK)   09154 Digestive system    04972 Pancreatic secretion     112668707 (CCK)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clud04052]     112668707 (CCK) Cytokines and neuropeptides [BR:clud04052]  Neuropeptides   GPCR binding    112668707 (CCK) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin PGLa-A Metal_resist Motif Other DBs NCBI-GeneID:  112668707 NCBI-ProteinID:  XP_025316974 Ensembl:  ENSCAFG00020025275 UniProt:  A0A8C0R7P5 LinkDB All DBs Position 23:complement(11486344..11492110) Genome browser AA seq 114 aa AA seqDB search MNGGVCLCVLLAVLAAGALAQPVPADPAGPGAQREDEAPRRQLRAVQKVDGEPRAHLGAL LARYIQQARKAPSGRMSVIKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgaacggcggcgtgtgcctgtgcgtgctgctggcggtactggcggcgggcgccctggcg cagcccgtcccggccgacccggcgggcccgggggcgcagcgggaggacgaggcgccccgg aggcagctgagggcagtgcagaaggtggacggcgagccccgcgcgcacctgggcgccctg ctggccaggtacatccagcaggcccggaaagctccttctggccgaatgtccgtcattaag aacctgcagaacctggaccccagtcacaggataagcgaccgggactacatgggctggatg gattttggccggcgtagtgctgaggagtatgaatacccctcctaa

DBGET integrated database retrieval system